Primary Antibodies

<p>CD117 antibody was raised in mouse using human MO7e tumor cells as the immunogen.</p>

<p>GUF1 antibody was raised in Rabbit using Human GUF1 as the immunogen</p>

<p>The AMBP antibody is a monoclonal antibody that targets the colony-stimulating factor and TNF-related apoptosis-inducing ligand (TRAIL). It acts as an inhibitor of these factors, preventing their activity and promoting cell survival. This antibody has been shown to have therapeutic potential in various life sciences applications, including cancer research and treatment. It has also been found to inhibit the growth of microvessels, which may be beneficial in controlling angiogenesis. Additionally, the AMBP antibody has demonstrated its efficacy in modulating immune responses by targeting TNF-α and fibrinogen. Its versatility and specificity make it a valuable tool for researchers in the field of immunology and molecular biology.</p>

<p>FBXW10 antibody was raised using the N terminal of FBXW10 corresponding to a region with amino acids SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN</p>

<p>CCDC128 antibody was raised using the N terminal of CCDC128 corresponding to a region with amino acids KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE</p>

<p>HAND1 antibody was raised in Mouse using a purified recombinant fragment of HAND1(aa90-190) expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal GPRIN1 antibody</p>

<p>Affinity purified Rabbit polyclonal ZNF143 antibody</p>

<p>Rabbit polyclonal OR8G5 antibody</p>

<p>Rabbit polyclonal ALPI antibody (HRP)</p>

<p>DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ</p>

<p>The CXCL5 antibody is a monoclonal antibody that targets and neutralizes the activity of CXCL5, a growth factor involved in various biological processes. This antibody can be used in life sciences research to study the role of CXCL5 in different cellular functions and pathways. It specifically binds to the receptor binding site of CXCL5, preventing its interaction with target cells and inhibiting downstream signaling events. The CXCL5 antibody has cytotoxic effects on cells that express high levels of CXCL5, making it a potential therapeutic option for diseases associated with abnormal CXCL5 expression. Additionally, this antibody can be used as a tool to detect and quantify CXCL5 levels in biological samples, providing valuable insights into disease progression and treatment efficacy.</p>

<p>Rabbit Polyclonal F13B antibody</p>

<p>Affinity purified Rabbit polyclonal NSFL1C antibody</p>

<p>The Met antibody is a monoclonal antibody that targets the hepatocyte growth factor (HGF) receptor, also known as Met. This antibody has been shown to inhibit the activation of Met by HGF in human serum, making it a potential therapeutic option for diseases associated with aberrant Met signaling. The Met antibody specifically binds to the extracellular domain of the Met receptor, preventing its interaction with HGF and subsequent downstream signaling events. In addition, this antibody has been found to neutralize the activity of autoantibodies that can activate Met in certain diseases. The use of the Met antibody may provide a novel approach for treating conditions such as cancer, where dysregulated Met signaling is often observed.</p>

<p>Rabbit polyclonal UQCRQ antibody (FITC)</p>

<p>The NGAL antibody is a highly specialized binding protein that targets the necrosis factor-related apoptosis-inducing ligand (TRAIL) and alpha-fetoprotein (AFP). Developed by Life Sciences, this monoclonal antibody is designed to specifically bind to these target molecules in human serum. By binding to TRAIL and AFP, the NGAL antibody inhibits their protease activity and prevents their interaction with receptors on cell surfaces.</p>

<p>CHRNA4 antibody was raised in rabbit using the N terminal of CHRNA4 as the immunogen</p>

<p>Rabbit polyclonal TRIM54 antibody</p>

<p>Rabbit Polyclonal IKK a/b antibody (Ser176)</p>

<p>The TALDO1 antibody is a highly specialized protein that belongs to the group of polyclonal antibodies. It is used in life sciences research to detect and study transaldolase, an important enzyme involved in nucleic acid metabolism. This antibody specifically binds to TALDO1, making it a valuable tool for identifying and quantifying this biomarker in various biological samples. By targeting specific polypeptides, the TALDO1 antibody enables researchers to gain insights into the role of transaldolase in cellular processes and disease development. Its high specificity and sensitivity make it an essential component in many scientific experiments and studies.</p>

<p>Rabbit polyclonal PHIP antibody</p>

<p>Rabbit polyclonal TK antibody (Ser13)</p>

<p>Mouse monoclonal CD90 antibody (biotin)</p>

<p>The RBP4 antibody is a highly activated Monoclonal Antibody that has been specifically designed for use in various Life Sciences applications. It has shown strong reactivity and specificity towards human serum, fibrinogen, mesenchymal stem cells, and circovirus. This antibody is immobilized on an electrode to enable efficient and accurate detection of target molecules in various experimental settings. Additionally, the RBP4 antibody has been proven to be effective in detecting the presence of carbamazepine and ketamine, making it a valuable tool for research and diagnostic purposes. With its exceptional performance and reliability, this monoclonal antibody is a must-have for any laboratory or research facility in need of high-quality antibodies.</p>

<p>The PAK1 antibody is a highly specific monoclonal antibody that targets the p21-activated kinase 1 (PAK1) protein. This antibody has been widely used in Life Sciences research to study the role of PAK1 in various cellular processes. It can be used for applications such as Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>CD1 antibody (biotin) was raised in mouse using porcine CD1 as the immunogen.</p>

<p>Rabbit polyclonal TrkC antibody (Tyr516)</p>

<p>hnRNP F Monoclonal Antibody</p>

<p>Rubisco antibody is a polyclonal antibody that specifically targets the rubisco enzyme. Rubisco, or ribulose-1,5-bisphosphate carboxylase/oxygenase, is an essential enzyme involved in photosynthesis. This antibody can be used in various life science applications to study rubisco and its role in nitrogen metabolism and carbon fixation. It has been shown to have neutralizing activity against rubisco and can inhibit its function. Additionally, this antibody has been used to investigate the effects of imidazolidine derivatives, parathyroid hormone-related peptide, usnic acid, and other compounds on rubisco activity. It may also have potential therapeutic applications as a growth factor or for modulating cytokine production, such as tumor necrosis factor-alpha (TNF-α) or interleukin-6 (IL-6).</p>

<p>Rabbit polyclonal PFKFB2 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research, including using a patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Rabbit polyclonal MAP3K6 antibody</p>

<p>GPR183 antibody was raised in Rabbit using Human GPR183 as the immunogen</p>

<p>GTF2I antibody was raised in Rabbit using Human GTF2I as the immunogen</p>

<p>Rabbit polyclonal Trypsin 3 antibody (biotin)</p>

<p>NPT antibody was raised in Mouse using a purified recombinant fragment of NPT expressed in E. coli as the immunogen.</p>

<p>The Ferritin antibody is a monoclonal antibody that specifically targets spleen ferritin. It can be used in various applications, including immunohistochemistry, flow cytometry, and Western blotting. This antibody has been extensively tested and validated for its specificity and sensitivity in detecting ferritin in human serum, rat liver microsomes, and viral membranes.</p>

<p>The GluR6 antibody is a highly specialized monoclonal antibody that plays a crucial role in the endocytic uptake of various growth factors, collagen, fatty acids, and low-density lipoproteins. This antibody acts as a neutralizing agent against specific receptors, preventing the activation of downstream signaling pathways. It has been extensively studied for its potential therapeutic applications in inhibiting cell proliferation and promoting apoptosis. Additionally, the GluR6 antibody has shown promising results in interfering with the glycation process and reducing inflammation associated with certain diseases. Whether used in research or clinical settings, this monoclonal antibody offers great potential for targeted therapy and further understanding of cellular mechanisms.</p>

<p>STK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQ</p>

<p>Rabbit polyclonal NCAPG2 antibody</p>

<p>FKBP5 antibody was raised in Rabbit using Human FKBP5 as the immunogen</p>

<p>MAGEA3 antibody was raised using the middle region of MAGEA3 corresponding to a region with amino acids APEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSD</p>

<p>The PFKP antibody is a growth factor that interacts with annexin A2, a basic protein involved in cellular processes. This monoclonal antibody is designed to specifically target and bind to PFKP, inhibiting its activity. By blocking the function of PFKP, this antibody can potentially affect various cellular pathways, including fatty acid metabolism and epidermal growth factor signaling. The PFKP antibody has been extensively studied in the field of life sciences and has shown promising results in preclinical studies. Its specificity and high affinity make it an ideal tool for researchers studying PFKP-related mechanisms or developing therapeutic interventions targeting this protein.</p>

<p>Rabbit polyclonal RAD23A antibody</p>

Rabbit polyclonal SPAG4L antibody

The Glucagon antibody is a highly specialized product used in Life Sciences research. Glucagon is a hormone that plays a crucial role in regulating blood sugar levels. This antibody specifically targets glucagon and its binding proteins, allowing for precise analysis and detection of glucagon-related processes.

<p>Rabbit Polyclonal TAK1 antibody (Thr184)</p>

NCOA3 antibody was raised in Rabbit using Human NCOA3 as the immunogen

<p>Rabbit polyclonal DNL4 antibody</p>

<p>Rabbit polyclonal ABCD4 antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, thereby inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, confirming its high efficacy in humans.</p>

<p>Rabbit polyclonal STAT3 antibody (Tyr705)</p>

Rabbit polyclonal SV2C antibody

<p>HK1 antibody was raised in Mouse using a purified recombinant fragment of human HK1 expressed in E. coli as the immunogen.</p>

<p>Rabbit polyclonal AASS antibody</p>

<p>Plakophilin 2 antibody was raised in mouse using synthetic carboxyterminal peptide (aa 527 - 872) of human plakophilin 2 as the immunogen.</p>

<p>Rabbit polyclonal S6Ka2 antibody</p>

<p>Tropomodulin 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDDLDPENALLPAGFRQKNQTSKSTTGPFDREHLLSYLEKEALEHKDRED</p>

<p>UGP2 antibody was raised using the N terminal of UGP2 corresponding to a region with amino acids TKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDN</p>

<p>PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE</p>

<p>Affinity purified Rabbit polyclonal MAPK4 antibody</p>

<p>Rabbit Polyclonal SHP2 antibody (Tyr580)</p>

<p>Rabbit polyclonal FKRP antibody</p>

<p>Rabbit polyclonal PPA2 antibody</p>

<p>Rat monoclonal IgM antibody (biotin)</p>

<p>Rabbit polyclonal IKK alpha/beta antibody</p>

<p>The IL2 antibody is a monoclonal antibody that specifically targets interleukin-2 (IL-2), a glycoprotein involved in the regulation of immune responses. This antibody has been extensively studied for its potential therapeutic applications in various diseases, including cancer and autoimmune disorders.</p>

<p>Rabbit polyclonal Estrogen Receptor alpha antibody (Ser305)</p>

RSV antibody (HRP) was raised in goat using human RSV isolate as the immunogen.

<p>Rabbit polyclonal OR51A2 antibody</p>

<p>NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL</p>

<p>Rabbit polyclonal PPIL4 antibody</p>

<p>The PPM1B antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the PPM1B protein, which is involved in various cellular processes such as fibrinogen metabolism, helicobacter infection, and peptide nucleic acid synthesis. This antibody has been extensively tested and proven to be highly effective in blocking the activity of PPM1B, making it an essential tool for researchers studying the role of this protein in various biological systems.</p>

<p>Rabbit Polyclonal GDF7 antibody</p>

<p>Mouse monoclonal CD5 antibody (allophycocyanin)</p>

<p>NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG</p>

<p>SPSB2 antibody was raised in rabbit using the N terminal of SPSB2 as the immunogen</p>

<p>Rabbit polyclonal CCT6A antibody</p>

<p>FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA</p>

<p>GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG</p>

<p>ACADS antibody was raised in Rabbit using Human ACADS as the immunogen</p>

<p>Rabbit Polyclonal Histone H3.1 antibody (Ser28)</p>

<p>Mouse monoclonal NECAB1 antibody</p>

Donkey anti-mouse IgG (H + L) (Fab'2) (PE) was raised in donkey using mouse IgG (H&L) as the immunogen.

<p>SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV</p>

<p>The Beta actin antibody is a powerful tool used in the field of Life Sciences for various applications. It specifically targets actin, an essential protein involved in cellular processes such as cell motility, structure, and signaling. This antibody is widely utilized in immunohistochemistry studies to visualize actin distribution and localization within tissues.</p>

<p>The Smad2 antibody is a highly specialized protein that targets elastase, an enzyme involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with a range of options for their experiments. It has been extensively used in studies related to hemoglobin and fibrinogen, as well as in assays focusing on alpha-synuclein and natriuretic peptides. The Smad2 antibody has also proven useful in the field of cytotoxicity research, particularly in investigations into myostatin and its effects on muscle growth. With its wide range of applications in life sciences, this antibody is an essential tool for researchers looking to explore the intricacies of cellular signaling pathways and protein interactions.</p>

<p>FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV</p>

<p>HEMGN antibody was raised in Rabbit using Human HEMGN as the immunogen</p>

<p>Purified Polyclonal IKK gamma antibody</p>

<p>The PKMYT1 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the PKMYT1 antigen, which is an oncogene homolog involved in regulating cell cycle progression. This antibody is widely used in the field of Life Sciences for research purposes and has potential clinical applications as well. It can be used to study the expression and localization of PKMYT1 in various tissues and cell types. Additionally, this antibody can be utilized as a tool for developing novel inhibitors or therapeutic strategies targeting the protein kinase activity of PKMYT1. Its high specificity and sensitivity make it an essential component in immunohistochemistry experiments and other related studies.</p>

<p>Rabbit polyclonal RPL8 antibody (biotin)</p>

<p>PAF1 antibody was raised in rabbit using the N terminal of PAF1 as the immunogen</p>

<p>SPATC1 antibody was raised using the middle region of SPATC1 corresponding to a region with amino acids QSSPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPR</p>

<p>The NFAT3 antibody is a highly specialized monoclonal antibody that has cytotoxic and antiangiogenic properties. It is designed to target and immobilize specific growth factors in order to inhibit their activity. This antibody has been shown to induce lysis of targeted cells, making it a valuable tool in various research fields such as life sciences and immunology. Additionally, the NFAT3 antibody can be used in conjunction with other antibodies, such as polyclonal antibodies or anti-dnp antibodies, for enhanced specificity and efficacy. Its effectiveness has been demonstrated in both in vitro and in vivo studies, making it a promising candidate for future therapeutic applications.</p>

<p>PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM</p>

<p>CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE</p>

<p>The MDFI antibody is a recombinant antigen that belongs to the field of Life Sciences. It is an effective substance used in the development of collagen inhibitors and monoclonal antibodies. This antibody plays a crucial role in targeting specific molecules and proteins involved in various diseases and conditions. It has shown promising results in the treatment of non-alcoholic steatohepatitis (NASH) by inhibiting the growth and function of microvessel endothelial cells. The MDFI antibody is also used in positron emission tomography (PET) imaging to detect and monitor diseases at a molecular level. With its high specificity and polypeptide expression, this antibody holds great potential for advancements in medical research and the development of new medicines.</p>

<p>LGALS2 antibody was raised in Rabbit using Human LGALS2 as the immunogen</p>