Primary Antibodies

<p>GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN</p>

C16orf71 antibody was raised in rabbit using the middle region of C16orf71 as the immunogen

<p>FAM20C antibody was raised using the middle region of FAM20C corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY</p>

<p>Purified Polyclonal PLCG1 antibody</p>

<p>Sideroflexin 3 antibody was raised using the middle region of SFXN3 corresponding to a region with amino acids TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN</p>

<p>FETUB antibody was raised using the N terminal of FETUB corresponding to a region with amino acids GCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRRGGLGSLFYL</p>

<p>CEBPD antibody was raised in rabbit using the middle region of CEBPD as the immunogen</p>

<p>PGCP antibody was raised using the N terminal of PGCP corresponding to a region with amino acids VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESA</p>

<p>SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV</p>

<p>TGFB3 antibody was raised in rabbit using the middle region of TGFB3 as the immunogen</p>

LUM antibody was raised in rabbit using the middle region of LUM as the immunogen

<p>DGCR2 antibody was raised using the N terminal of DGCR2 corresponding to a region with amino acids MVPKADSGAFLLLFLLVLTVTEPLRPELRCNPGQFACRSGTIQCIPLPWQ</p>

<p>WBP4 antibody was raised in rabbit using the N terminal of WBP4 as the immunogen</p>

GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA

The GPT Antibody is a polyclonal antibody that is commonly used in immunohistochemistry studies. It is an essential tool in the field of life sciences for detecting and analyzing various proteins and antigens. This antibody specifically targets the GPT protein, which is involved in numerous biological processes, including interferon signaling and chemokine binding.

<p>Serotonin receptor 3C antibody was raised using a synthetic peptide corresponding to a region with amino acids CCPTAPQKGNKGLGLTLTHLPGPKEPGELAGKKLGPRETEPDGGSGWTKT</p>

<p>UBL4A antibody was raised in rabbit using the middle region of UBL4A as the immunogen</p>

<p>JMJD5 antibody was raised in rabbit using the middle region of JMJD5 as the immunogen</p>

<p>NPHP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG</p>

<p>SOD2 antibody was raised using the N terminal of SOD2 corresponding to a region with amino acids MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH</p>

<p>SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ</p>

<p>EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG</p>

<p>Zfr antibody was raised in rabbit using the N terminal of Zfr as the immunogen</p>

<p>RWDD1 antibody was raised in rabbit using the middle region of RWDD1 as the immunogen</p>

<p>UBLCP1 antibody was raised in rabbit using the N terminal of UBLCP1 as the immunogen</p>

SLC30A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG

<p>SRD5A2 antibody was raised using the N terminal of SRD5A2 corresponding to a region with amino acids MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR</p>

<p>TAGLN 3 antibody was raised in rabbit using the N terminal of TAGLN 3 as the immunogen</p>

<p>CPNE9 antibody was raised in rabbit using the C terminal of CPNE9 as the immunogen</p>

<p>Affinity purified Goat polyclonal Mouse Transferrin antibody</p>

MCOLN3 antibody was raised in rabbit using the middle region of MCOLN3 as the immunogen

<p>IL4 antibody was raised using the middle region of IL4 corresponding to a region with amino acids LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS</p>

<p>CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL</p>

<p>FXYD7 antibody was raised using the N terminal of FXYD7 corresponding to a region with amino acids MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK</p>

<p>IL3 antibody was raised in rabbit using highly pure recombinant murine IL-3 as the immunogen.</p>

Atp5d antibody was raised in rabbit using the C terminal of Atp5d as the immunogen

<p>Lipase antibody (Gastric) was raised using the N terminal of LIPF corresponding to a region with amino acids ISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH</p>

<p>BBS10 antibody was raised in rabbit using the C terminal of BBS10 as the immunogen</p>

<p>PLEKHA7 antibody was raised in rabbit using the middle region of PLEKHA7 as the immunogen</p>

<p>NTSR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT</p>

<p>Purified Polyclonal CRMP3 antibody</p>

<p>EIF4A3 antibody was raised in rabbit using the N terminal of EIF4A3 as the immunogen</p>

<p>ZNF583 antibody was raised in rabbit using the N terminal of ZNF583 as the immunogen</p>

<p>C10ORF38 antibody was raised using the middle region of C10Orf38 corresponding to a region with amino acids ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE</p>

<p>SLC39A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG</p>

<p>RBM6 antibody was raised in rabbit using the N terminal of RBM6 as the immunogen</p>

<p>MICA antibody was raised using the N terminal of MICA corresponding to a region with amino acids LHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQ</p>

<p>GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSMF</p>

<p>GPRC5B antibody was raised in rabbit using the N terminal of GPRC5B as the immunogen</p>

<p>IL8RB antibody was raised using the N terminal of IL8RB corresponding to a region with amino acids MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF</p>

<p>POGK antibody was raised in rabbit using the middle region of POGK as the immunogen</p>

<p>ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF</p>

<p>SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth.</p>

<p>MYBPH antibody was raised in rabbit using the middle region of MYBPH as the immunogen</p>

<p>IFN Gamma antibody was raised in rabbit using highly pure recombinant murine IFN-gamma as the immunogen.</p>

<p>E.coli-derived,-18.7 kDa-Recombinant-Murine IL-10</p>

<p>SIGLEC7 antibody was raised using the middle region of SIGLEC7 corresponding to a region with amino acids WRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSLQQ</p>

<p>TMPRSS5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDYDVALLRLQTALN</p>

<p>SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV</p>

<p>ApoE3 antibody was raised in rabbit using highly pure recombinant human ApoE3 as the immunogen.</p>

<p>KIF2B antibody was raised using the middle region of KIF2B corresponding to a region with amino acids CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF</p>

<p>CDH7 antibody was raised using the N terminal of CDH7 corresponding to a region with amino acids PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP</p>

<p>SLC18A1 antibody was raised in rabbit using the middle region of SLC18A1 as the immunogen</p>

GPR6 antibody was raised using the N terminal of GPR6 corresponding to a region with amino acids NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN

Anti-Human PCSK9 Monoclonal Antibody; 98%

<p>Pig RBC antibody was raised in rabbit using porcine erythrocytes as the immunogen.</p>

Contains 0.1% Proclin300 as preservative

<p>Anti-Human Nectin-4 Monoclonal Antibody</p>

Sheep polyclonal Creatinine Acid antibody

The Androstenedione antibody is a highly specialized antibody that targets and binds to androstenedione, a hormone involved in the production of testosterone and estrogen. This antibody has been extensively studied for its role in various research areas, including hormone regulation, reproductive health, and cancer studies.

Please enquire for more information about Brucella Abortus Antigen including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Monoclonal antibody against RANKL; anti-resorptive agent for osteoperosis treatment</p>

Please enquire for more information about Dengue Virus Type 3 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>Blinatumomab is a bispecific T-cell engager (BiTE), an immunotherapy specifically designed to target and redirect the body's immune system to attack cancer cells. This is possible as Blinatumomab has two single-chain antibody variable fragments. One of these targets CD3+ on T-cells while the other recognizes CD19 on malignant B-cells. As such the body's T-cells become activated and exert cytotoxic activity on the target cell.<br>Blinatumomab has been approved for the treatment of a type of acute lymphoblastic leukemia (ALL) called Philadelphia chromosome-negative B-cell precursor ALL. This medication has demonstrated efficacy in patients with relapsed or refractory ALL, and it has also been used in the minimal residual disease (MRD) setting to help eliminate any remaining cancer cells after initial treatment. <br>One advantage of Blinatumomab is that, CD3 and CD19 are present in both pediatric and adult patients. As such it can be a potential therapeutic for both patient sets.</p>

<p>Please enquire for more information about HBsAg Mouse Monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Dengue Virus Type 1 Envelope Antigen, Recombinant including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Monoclonal antibody against EGFR

NCGC00229600: Allosteric inverse TSHR agonist; blocks TSH and antibody TSHR activation; for Graves' disease research.

Mucin antibody was raised in mouse using Mucin isolated from ovarian mucinous cysts and colonic mucosa as the immunogen.

<p>CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.</p>

Benzoylecgonine antibody was raised in mouse using benzoyl ecgonine-BSA as the immunogen.

<p>The Methotrexate antibody is a monoclonal antibody that specifically targets and binds to Methotrexate, a commonly used cytotoxic drug in the field of Life Sciences. This antibody has been extensively tested and validated for its high affinity and specificity towards Methotrexate. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The Methotrexate antibody works by binding to Methotrexate molecules and preventing their interaction with their target enzymes involved in DNA synthesis. This inhibits the growth of cancer cells and autoimmune responses mediated by activated T-cells. Additionally, this antibody can also be utilized as a tool for studying the intracellular localization and trafficking of Methotrexate within cells. The unique features of this Methotrexate antibody include its ability to recognize both free Methotrexate molecules as well as Methotrexate conjugated to proteins or other biomolecules. It exhibits minimal cross-reactivity with</p>

<p>Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.</p>

<p>The CYFRA21-1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets fibronectin, a protein involved in cell adhesion and migration. It has cytotoxic properties, making it useful for studying cellular processes and identifying potential therapeutic targets. Additionally, the CYFRA21-1 antibody can be used to detect inhibitory factors or antiphospholipid antibodies in biological samples. It is also effective in detecting insulin antibodies, autoantibodies, and antibodies involved in glycosylation processes. With its high specificity and sensitivity, this monoclonal antibody is an invaluable tool for researchers looking to uncover new insights into various biological pathways and disease mechanisms.</p>

Progesterone-3 antibody was raised in sheep using 17-OH-Progesterone-3-BSA as the immunogen.

<p>The Tetracycline antibody is a highly specific monoclonal antibody that binds to tetracycline, a broad-spectrum antibiotic. This antibody has a high receptor binding affinity and can be used in various applications, such as polymerase chain reactions (PCR), immunohistochemistry, and Western blotting. It specifically targets tetracycline residues in biological samples, allowing for the detection and quantification of this antibiotic. In addition to its use in research, the Tetracycline antibody has potential applications in the field of medicine. It can be used to study the cellular localization of tetracycline within cells or tissues, providing valuable insights into its mechanism of action. Furthermore, this antibody can be utilized to investigate protein-protein interactions involving tetracycline or its derivatives. The Tetracycline antibody is produced using advanced techniques in monoclonal antibody production. It exhibits high specificity and sensitivity, ensuring reliable and accurate results. This antibody is compatible with various sample types, including</p>

<p>2A peptide-linked polycistronic vectors can be used to express multiple proteins from a single open reading frame (ORF). The small 2A peptide sequences, when cloned between genes, allows for efficient, stoichiometric production of discrete protein products within a single vector through a novel "cleavage" event within the 2A peptide sequence. 2A was discovered in the foot-and-mouth disease virus (FMDV, a picornavirus). The 2A peptide acts through ribosomal skipping to allow for the encoding of polyproteins which can dissociate into individual proteins upon translation. Anti-T2A antibody recognises 2A tagged recombinant proteins and is an excellent tool for researchers using 2A peptide based expression systems.<br>0.2mg/ml TEA (Rb L02T), 0.5mg/ml Glycine (Rb L02G). Used for ELISA (1:1000). Reacts with T2A tag.</p>

<p>Primate-specific Mas-related G protein-coupled receptor-X1 (MRGPR-X1) is highly enriched in dorsal root ganglia (DRG) neurones as well as in connective tissue mast cells (CTMC) and the leukaemia-derived human mast cell line (LAD)-2. MRGPR-X1 activation induces acute pain and therefore represents a promising target for future pain therapy. MRGPR-X1 is activated by bovine adrenal medulla peptide-8-22 (BAM 8-22) which is cleaved from pro-enkephalin by pro-hormone convertases. Unlike most if not all Gq-coupled receptors MRGPR-X1 does not undergo agonist-promoted endocytosis. Data: Western blot analysis of rat brain preparation. Lane 1: Rat brain preparation (20µg). Secondary: Goat anti-rabbit IgG conjugated to HRP 1:5000.</p>

<p>Extracellular signal-regulated kinase 1/2 (ERK1/2) is a mitogen-activated protein kinase (MAPK) family protein and part of the Ras-Raf-MEK-ERK signalling pathway which plays a key role in controlling cell proliferation, differentiation and cell survival. ERK1/2 acts downstream of activated growth factor receptors, RAF protein kinases and mitogen-activated protein kinase kinases 1 and 2 (MEK1/2). MEK1 and MEK2 activate ERK1/2 by phosphorylation and once activated ERK1/2 enters the nucleus and phosphorylates transcription factors to induce changes in gene expression. In addition to this active ERK1/2 also translocates to other organelles including the endoplasmic reticulum, endosomes, golgi and mitochondria where it influences cell physiology. Overall ERK1/2 phosphorylates more than 200 different substrates including other protein kinases, transcription factors, RNA-binding proteins, regulators of mRNA translation and regulators of cell death. ERK1/2 pathway is strongly implicated in cancer where its hyperactivation underpins the growth and maintenance of many tumour types. Data: Western blot analysis of whole cell extract of Mouse embryonic Fibroblasts (MEFs).</p>

Anti-Trop2

<p>This gene encodes the 125-kDa catalytic subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 6. [provided by RefSeq, Mar 2012],</p>

<p>caution:The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.,function:Location-regulated scaffolding protein connecting MEK to RAF. Promotes MEK and RAF phosphorylation and activity through assembly of an activated signaling complex. By itself, it has no demonstrated kinase activity.,PTM:Phosphorylated on Ser-309 and, to a higher extent, on Ser-404 by MARK3. Dephosphorylated on Ser-404 by PPP2CA. In resting cells, phosphorylated KSR1 is cytoplasmic and in stimulated cells, dephosphorylated KSR1 is membrane-associated.,similarity:Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.,similarity:Contains 1 phorbol-ester/DAG-type zinc finger.,similarity:Contains 1 protein kinase domain.,subcellular location:In unstimulated cells, where the phosphorylated form is bound to a 14-3-3 protein, sequestration in the cytoplasm occurs. Following growth factor treatment, the protein is free for membrane translocation, and it moves from the cytoplasm to the cell periphery.,subunit:Interacts with HSPCA/HSP90, YWHAB/14-3-3, CDC37, MAP2K/MEK, MARK3, PPP2R1A and PPP2CA. Also interacts with RAF and MAPK/ERK, in a Ras-dependent manner (By similarity). The binding of 14-3-3 proteins to phosphorylated KSR prevents the membrane localization.,</p>

<p>The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding d</p>

<p>This gene encodes a class I seven-transmembrane G-protein-coupled receptor. The encoded protein is a receptor for angiotensin-(1-7) and preferentially couples to the Gq protein, activating the phospholipase C signaling pathway. The encoded protein may play a role in multiple processes including hypotension, smooth muscle relaxation and cardioprotection by mediating the effects of angiotensin-(1-7). [provided by RefSeq, May 2012],</p>

<p>The product of this gene belongs to the serine/threonine protein kinases family, and to the Ca(2+)/calmodulin-dependent protein kinases subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. This calcium calmodulin-dependent protein kinase is composed of four different chains: alpha, beta, gamma, and delta. The alpha chain encoded by this gene is required for hippocampal long-term potentiation (LTP) and spatial learning. In addition to its calcium-calmodulin (CaM)-dependent activity, this protein can undergo autophosphorylation, resulting in CaM-independent activity. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Nov 2008],</p>

<p>p38 MAP kinase (MAPK) is the mammalian orthologue of the yeast HOG kinase that participates in a signaling cascade controlling cellular responses to cytokines and stress. Isoforms p38α, β, γ and δ have been identified. p38 MAPK is activated by a variety of cellular stresses including osmotic shock, inflammatory cytokines, lipopolysaccharide (LPS), UV light, and growth factors.</p>

<p>The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2011]</p>