Primary Antibodies

Rabbit polyclonal IL10Ra antibody (Tyr496)

Adenovirus antibody (FITC) was raised in goat using hexon from ADV, type 2 as the immunogen.

The PFKP antibody is a highly specialized monoclonal antibody that targets the PFKP protein. This protein plays a crucial role in various cellular processes, including chemokine signaling, cytotoxicity, and growth factor regulation. The PFKP antibody is designed to specifically bind to the PFKP protein, neutralizing its activity and preventing it from interacting with other molecules.

The CD122 antibody is a highly effective therapeutic tool that belongs to the class of activated monoclonal antibodies. It specifically targets CD122, a receptor for vasoactive intestinal peptide, which is involved in various physiological processes. This antibody has shown promising results in the treatment of autoimmune disorders, as it can neutralize autoantibodies and promote cytotoxic effects on target cells. Additionally, the CD122 antibody can be used in the development of chimeric receptors for immunotherapy purposes. With its high specificity and potency, this monoclonal antibody has gained significant attention in the field of Life Sciences. Its ability to induce necrosis factor-related apoptosis-inducing ligand (TRAIL)-mediated cell death makes it a valuable tool for cancer research and therapy. The CD122 antibody is derived from human monoclonal antibodies and has been extensively studied for its potential use in nuclear medicine, as well as its ability to enhance immune response and multidrug resistance.

ENTHD1 antibody was raised using the middle region of ENTHD1 corresponding to a region with amino acids RAIARLHEDLSTVIQELNVINNILMSMSLNSSQISQSSQVPQSSEGSSDQ

ARFIP2 antibody was raised in Rabbit using Human ARFIP2 as the immunogen

The XIAP antibody is a highly specialized and activated monoclonal antibody that targets specific proteins involved in cell growth and survival. It is particularly effective against autoantibodies and glycosylation, which can disrupt normal cellular function. The XIAP antibody has been shown to inhibit the activity of insulin and epidermal growth factor, two important growth factors involved in cell proliferation. Additionally, it has demonstrated the ability to neutralize alkaline phosphatases and anti-acth antibodies, which are known to contribute to various diseases. This antibody is a powerful tool in life sciences research and can be used in a variety of applications, including diagnostics, therapeutics, and protein analysis. With its high specificity and potency, the XIAP antibody is an indispensable asset for scientists and researchers in the field.

Transferrin antibody was raised in mouse using purified transferrin from pooled human plasma as the immunogen.

Also known as Protein Kinase B (PKB), Akt is a signaling protein in cells that regulates important processes like cell growth, survival, metabolism, and proliferation. It functions within the PI3K/Akt pathway, one of the primary pathways for cell survival and growth. This pathway is activated by growth factors and hormones such as insulin. Upon activation, Akt is recruited to the cell membrane, where it is phosphorylated by kinases like PDK1, triggering its full activation. Akt can then influence downstream processes, inhibiting apoptosis to promote cell survival, supporting cell growth via pathways like mTOR, and enhancing glucose metabolism.Akt plays a key role in diseases like cancer and diabetes. Dysregulation of the Akt pathway is frequently observed in cancer, often due to mutations in pathway components such as PI3K, PTEN, or Akt itself, resulting in increased cell survival, growth, and resistance to therapies. In diabetes, insulin resistance diminishes Akt pathway responsiveness, reducing glucose uptake and leading to elevated blood glucose levels. Thus, the Akt pathway is a focal point in therapeutic research, particularly for diseases where its regulatory effects on cell growth and metabolism are implicated.

Rabbit polyclonal RPS13 antibody

ADRB2 antibody was raised in Rabbit using Human ADRB2 as the immunogen

The Actin antibody is a highly specific antibody that targets actin, a protein essential for cellular structure and movement. It is widely used in Life Sciences research to study the role of actin in various biological processes. This antibody has been validated for multiple applications, including immunofluorescence (IF), immunohistochemistry (IHC), Western blotting, and flow cytometry.

Mouse monoclonal NIT2 antibody

Rabbit polyclonal Cyclin H antibody (Thr315)

DPF2 antibody was raised in mouse using recombinant Human D4, Zinc And Double Phd Fingers Family 2 (Dpf2),

DMAP1 antibody was raised in Rabbit using Human DMAP1 as the immunogen

S100 antibody was raised in mouse using human brain S-100 protein as the immunogen.

Calpain 1 antibody was raised in mouse using purified bovine skeletal muscle 80 kDa mu-calpain subunit as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its effectiveness has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.

Mouse monoclonal CNBP antibody

The SMAD3 antibody is a monoclonal antibody that specifically targets pancreatic elastase. It belongs to the group of antibodies that are used in various life sciences applications, such as hybridization studies and protein detection. The SMAD3 antibody has been shown to have cytotoxic effects on human hepatocytes, inhibiting their growth and viability. Additionally, this antibody can be used in research to study the role of SMAD3 in natriuretic and growth factor signaling pathways. It has also been used in diagnostic assays to detect the presence of digoxin, a cardiac glycoside, in human serum samples. With its high specificity and affinity for its target, the SMAD3 antibody is an invaluable tool for researchers in the field of molecular biology and biomedical sciences.

The GCK antibody is a monoclonal antibody that has various applications in the field of Life Sciences. It can be used in research studies to detect and analyze the expression of certain proteins and markers. The GCK antibody specifically targets the growth factor-1 receptor, which plays a crucial role in cell growth and development. This antibody can be used to study the activation and signaling pathways of this receptor.

The CDH2 antibody is a valuable tool in the field of Life Sciences, particularly in pluripotent stem cell research. This antibody specifically targets CDH2, also known as N-cadherin, which plays a crucial role in cell-cell adhesion and syncytia formation. It has been extensively validated for various applications, including immunohistochemistry, Western blotting, and flow cytometry.

The A1AT antibody is a powerful tool in the field of Life Sciences. It is activated to target specific proteins like dopamine and fibrinogen, making it an invaluable resource for researchers studying various biological processes. Additionally, this antibody has been proven effective as a cephalosporin inhibitor, blocking the activity of enzymes in this family and preventing bacterial growth. With its unique ability to interact with tyrosine residues, the A1AT antibody can also be used to study the effects of steroids and antibiotics on cellular processes. Whether you're conducting experiments or developing new therapies, the A1AT antibody is a versatile tool that will enhance your research capabilities.

Rabbit Polyclonal NFkB p65 antibody (Ser276)

MMP1 antibody was raised in Rabbit using Human MMP1 as the immunogen

SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

CRX antibody was raised in Rabbit using Human CRX as the immunogen

Rabbit polyclonal PRPSAP1 antibody

FAM3D antibody was raised using the middle region of FAM3D corresponding to a region with amino acids LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP

LYL1 antibody was raised in Rat using LYL1 peptide coupled to carrier protein as the immunogen.

The HAV VP1 antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets the protein known as VP1, which is a growth factor involved in various cellular processes. This antibody has been shown to have neutralizing properties, meaning it can block the activity of VP1 and prevent its effects on cells. The HAV VP1 antibody has also been used in studies involving other drugs such as sorafenib and trastuzumab, where it enhances their cytotoxic effects. Additionally, this antibody has shown binding affinity towards collagen and mycoplasma genitalium, indicating its potential use in research related to these entities. Furthermore, it has been found to have anti-acth antibodies and egf-like properties, further expanding its potential applications within the scientific community.

Rabbit Polyclonal p70 S6 Kinase antibody (Ser411)

The INA antibody is a monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets androgen receptor (AR) signaling, which plays a crucial role in various biological processes. The INA antibody can be used in assays to detect and quantify AR levels, as well as to study the effects of AR modulation on downstream signaling pathways.

The IL32 antibody is a polyclonal antibody that is commonly used in the field of life sciences. It is specifically designed to target and neutralize IL32, an important protein involved in various biological processes. This antibody can be used for research purposes, such as studying the role of IL32 in disease development or evaluating its therapeutic potential.

JMJD2B antibody was raised using the middle region of JMJD2B corresponding to a region with amino acids SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV

The HKR2 antibody is a specific antibody that has been widely used in Life Sciences research. It is a monoclonal antibody that specifically recognizes and binds to the HKR2 protein, which is involved in various cellular processes. This antibody can be used in different applications such as laser ablation, flow assays, and chemiluminescent immunoassays.

CNNM3 antibody was raised in Rabbit using Human CNNM3 as the immunogen

Mouse monoclonal HIF1A antibody

Rabbit polyclonal PPP2R2B antibody

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to combat tuberculosis infections and contains active compounds that exhibit strong bactericidal activity. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, which prevents transcription and replication. The effectiveness of this drug has been extensively studied using advanced techniques like the patch-clamp technique on human erythrocytes.