Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Arntl2 antibody
Arntl2 antibody was raised in rabbit using the C terminal of Arntl2 as the immunogen
Purity:Min. 95%Goat anti Human IgG (Alk Phos)
Goat anti-human IgG (Alk Phos) was raised in goat using human IgG F(c) fragment as the immunogen.
Purity:Min. 95%ARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
UBE2J2 antibody
UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
SLC1A5 antibody
SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
BP1 antibody
The BP1 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. This antibody specifically targets and binds to BP1, a protein that is found in human serum. The binding of the BP1 antibody to its target protein can be used for various applications, including research and diagnostic purposes.
EPHA3 antibody
The EPHA3 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It targets the fatty acid receptor EPHA3, which plays a crucial role in various cellular processes such as cell growth and differentiation. This antibody has been extensively studied and validated for its ability to specifically bind to EPHA3, making it an essential tool for researchers working in this area.
PSA antibody
The PSA antibody is a monoclonal antibody that specifically targets the prostate-specific antigen (PSA) found in human serum. It is designed to bind to PSA and inhibit its activity. This antibody is produced using histidine-tagged recombinant proteins and has been shown to effectively detect PSA levels in various diagnostic tests, such as enzyme-linked immunosorbent assays (ELISA) or immunohistochemistry.
MTRR antibody
MTRR antibody was raised using the N terminal of MTRR corresponding to a region with amino acids YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
GOLM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been proven through extensive testing using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
DLC1 antibody
DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
Goat anti Human Lambda Chain (Fab'2)
Goat anti-human lambda chain (Fab'2) was raised in goat using human l (lambda) light chain as the immunogen.
Purity:Min. 95%BTBD10 antibody
BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
PNPLA3 antibody
PNPLA3 antibody was raised using the C terminal of PNPLA3 corresponding to a region with amino acids CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS
TAF1 antibody
The TAF1 antibody is a powerful tool in the field of Life Sciences. It specifically targets and neutralizes the endonuclease activity of TAF1, an enzyme involved in various cellular processes such as carbonic and glutamate metabolism, growth factor signaling, and histidine biosynthesis. This monoclonal antibody has been extensively tested and proven to effectively inhibit TAF1's hyaluronidase activity, which is crucial for tissue remodeling and cell migration. Additionally, it has been shown to reduce microvessel density in tumor models, making it a potential therapeutic option for angiogenesis-related disorders. With its high specificity and affinity, the TAF1 antibody is an invaluable asset for researchers in need of reliable tools to study TAF1 function and its implications in various biological processes.
Smpdl3a antibody
Smpdl3a antibody was raised in rabbit using the N terminal of Smpdl3a as the immunogen
Purity:Min. 95%GTPBP2 antibody
GTPBP2 antibody was raised using the C terminal of GTPBP2 corresponding to a region with amino acids VLLFHATTFRRGFQVTVHVGNVRQTAVVEKIHAKDKLRTGEKAVVRFRFL
TL1A antibody
TL1A antibody was raised in rabbit using highly pure recombinant human TL-1A as the immunogen.
Purity:Min. 95%ME1 antibody
ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL
VAMP5 antibody
VAMP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
