Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75621 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NEURL2 antibody
NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Purity:Min. 95%AGK antibody
AGK antibody was raised in rabbit using the N terminal of AGK as the immunogenPurity:Min. 95%HAS3 antibody
HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDPurity:Min. 95%PCDHGC4 antibody
PCDHGC4 antibody was raised using the N terminal of PCDHGC4 corresponding to a region with amino acids VKKRSDGSLVPELLLEKPLDREKQSDYRLVLTAVDGGNPPRSGTAELRVSPurity:Min. 95%Dcdc2a antibody
Dcdc2a antibody was raised in rabbit using the N terminal of Dcdc2a as the immunogenPurity:Min. 95%OR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurity:Min. 95%SDCBP antibody
SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVPurity:Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIPurity:Min. 95%ARMCX3 antibody
ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEPurity:Min. 95%CDC4 (69kDa) antibody
CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.Purity:Min. 95%PCDH12 antibody
PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTPurity:Min. 95%Junctophilin 1 antibody
Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGPurity:Min. 95%PRELP antibody
PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHPurity:Min. 95%DNASE2B antibody
DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%AK3 antibody
AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
Purity:Min. 95%NLK antibody
NLK antibody was raised in rabbit using the middle region of NLK as the immunogenPurity:Min. 95%
