Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75621 products of "Primary Antibodies"
ZHX2 antibody
The ZHX2 antibody is a powerful tool used in the field of Life Sciences. It specifically targets and binds to collagen, a protein found abundantly in the body. This antibody has shown antinociceptive properties, meaning it can help alleviate pain sensations. Additionally, it has been observed to be effective in inhibiting the activation of certain phosphorylation sites, which play a crucial role in cellular signaling pathways.
Purity:Min. 95%MIF antibody
MIF antibody was raised in rabbit using the middle region of MIF as the immunogen
Purity:Min. 95%ST6GALNAC3 antibody
ST6GALNAC3 antibody was raised using the C terminal of ST6GALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWTPurity:Min. 95%CAMKII antibody
CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMPurity:Min. 95%PSMB10 antibody
PSMB10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGPurity:Min. 95%FGF13 antibody
FGF13 antibody was raised using the middle region of FGF13 corresponding to a region with amino acids TKLYSRQGYHLQLQADGTIDGTKDEDSTYTLFNLIPVGLRVVAIQGVQTKPurity:Min. 95%SMC2 antibody
SMC2 antibody was raised using the middle region of SMC2 corresponding to a region with amino acids ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYRPurity:Min. 95%PODXL antibody
PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQPurity:Min. 95%TMEM161B antibody
TMEM161B antibody was raised using the N terminal of TMEM161B corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLHPurity:Min. 95%MRGPRX3 antibody
MRGPRX3 antibody was raised in rabbit using the C terminal of MRGPRX3 as the immunogenPurity:Min. 95%OAS2 antibody
OAS2 antibody was raised using the middle region of OAS2 corresponding to a region with amino acids AKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEPurity:Min. 95%TRMT6 antibody
TRMT6 antibody was raised in rabbit using the middle region of TRMT6 as the immunogenPurity:Min. 95%ZFP42 antibody
ZFP42 antibody was raised in rabbit using the middle region of ZFP42 as the immunogenPurity:Min. 95%SIRT7 antibody
SIRT7 antibody was raised in rabbit using the C terminal of SIRT7 as the immunogenPurity:Min. 95%ZNF433 antibody
ZNF433 antibody was raised in rabbit using the N terminal of ZNF433 as the immunogenPurity:Min. 95%CD298 antibody
The CD298 antibody is a highly specific monoclonal antibody that targets DNA-binding proteins. It is widely used in the field of Life Sciences for various applications, including research and diagnostics. This antibody binds specifically to the surface glycoprotein CD298, forming a specific complex that can be detected using techniques such as electrochemical impedance spectroscopy. The CD298 antibody has been shown to have high affinity and specificity for its target, making it a valuable tool for studying the function and localization of DNA-binding proteins in various biological systems. Additionally, this antibody has been used in studies investigating the role of CD298 in processes such as glutamate signaling and proteolytic activity. With its versatility and reliability, the CD298 antibody is an essential tool for researchers working in the field of DNA-binding proteins.
Purity:Min. 95%SERTAD2 antibody
SERTAD2 antibody was raised in rabbit using the N terminal of SERTAD2 as the immunogenPurity:Min. 95%SNRPA antibody
SNRPA antibody was raised in rabbit using the N terminal of SNRPA as the immunogen
Purity:Min. 95%WNT2B antibody
WNT2B antibody was raised in rabbit using the middle region of WNT2B as the immunogenPurity:Min. 95%Armcx1 antibody
Armcx1 antibody was raised in rabbit using the C terminal of Armcx1 as the immunogenPurity:Min. 95%
