Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75621 products of "Primary Antibodies"
OR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurity:Min. 95%SDCBP antibody
SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVPurity:Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIPurity:Min. 95%ARMCX3 antibody
ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEPurity:Min. 95%CDC4 (69kDa) antibody
CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.Purity:Min. 95%PCDH12 antibody
PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTPurity:Min. 95%Junctophilin 1 antibody
Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGPurity:Min. 95%PRELP antibody
PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHPurity:Min. 95%DNASE2B antibody
DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%AK3 antibody
AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
Purity:Min. 95%NLK antibody
NLK antibody was raised in rabbit using the middle region of NLK as the immunogenPurity:Min. 95%DLG3 antibody
DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGPurity:Min. 95%SLC6A3 antibody
SLC6A3 antibody was raised in rabbit using the N terminal of SLC6A3 as the immunogenPurity:Min. 95%SLC26A10 antibody
SLC26A10 antibody was raised in rabbit using the N terminal of SLC26A10 as the immunogen
Purity:Min. 95%BCL10 antibody
BCL10 antibody was raised in rabbit using C terminal sequence [EMFLPLRSRTVSRQC] of Bcl10 as the immunogen.
Purity:Min. 95%MIP1 alpha antibody
MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.
Purity:Min. 95%FGFR1 antibody
The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.
Purity:Min. 95%
