Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75621 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
TMEM38B antibody
TMEM38B antibody was raised using the C terminal of TMEM38B corresponding to a region with amino acids WMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNEPurity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the middle region of SMYD1 as the immunogen
Purity:Min. 95%PNPLA4 antibody
PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKMPurity:Min. 95%PTDSS2 antibody
PTDSS2 antibody was raised in rabbit using the middle region of PTDSS2 as the immunogenPurity:Min. 95%Glycoprotein 2 antibody
Glycoprotein 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVESPurity:Min. 95%LOC653428 antibody
LOC653428 antibody was raised in rabbit using the C terminal of LOC653428 as the immunogenPurity:Min. 95%CTCFL antibody
CTCFL antibody was raised in rabbit using the N terminal of CTCFL as the immunogenPurity:Min. 95%C6ORF64 antibody
C6ORF64 antibody was raised using the C terminal Of C6Orf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGRPurity:Min. 95%SLC25A20 antibody
SLC25A20 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWPurity:Min. 95%POLR2B antibody
POLR2B antibody was raised in rabbit using the middle region of POLR2B as the immunogenPurity:Min. 95%MIP1 beta antibody
MIP1 beta antibody was raised in rabbit using highly pure recombinant murine MIP-1beta as the immunogen.Purity:Min. 95%TMEM82 antibody
TMEM82 antibody was raised using the N terminal of TMEM82 corresponding to a region with amino acids LETVHLAGLALFLTVVGSRVAALVVLEFSLRAVSTLLSLGKGSQGAAERLPurity:Min. 95%SDF4 antibody
SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEEPurity:Min. 95%ZDHHC17 antibody
ZDHHC17 antibody was raised using the middle region of ZDHHC17 corresponding to a region with amino acids LFYNFGKSWKSDPGIIKATEEQKKKTIVELAETGSLDLSIFCSTCLIRKPPurity:Min. 95%UTP18 antibody
UTP18 antibody was raised in rabbit using the N terminal of UTP18 as the immunogenPurity:Min. 95%HGF antibody
HGF antibody was raised in rabbit using the middle region of HGF as the immunogenPurity:Min. 95%CDS1 antibody
CDS1 antibody was raised in rabbit using the N terminal of CDS1 as the immunogen
Purity:Min. 95%Pura antibody
Pura antibody was raised in rabbit using the C terminal of Pura as the immunogen
Purity:Min. 95%BTNL3 antibody
BTNL3 antibody was raised using the N terminal of BTNL3 corresponding to a region with amino acids EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Purity:Min. 95%ENPP6 antibody
ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWSPurity:Min. 95%
