Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
DEDD2 antibody
DEDD2 antibody was raised in rabbit using the middle region of DEDD2 as the immunogen
Purity:Min. 95%ZNF662 antibody
ZNF662 antibody was raised in rabbit using the middle region of ZNF662 as the immunogenPurity:Min. 95%COPA antibody
COPA antibody was raised using the middle region of COPA corresponding to a region with amino acids IPKDADSQNPDAPEGKRSSGLTAVWVARNRFAVLDRMHSLLIKNLKNEITPurity:Min. 95%Tau antibody
The Tau antibody is a highly specialized antibody that targets and interacts with the protein tau. Tau is involved in various cellular processes, including the stabilization of microtubules. This antibody has been extensively studied for its potential role in neurodegenerative diseases like Alzheimer's disease.Purity:Min. 95%Arsb antibody
Arsb antibody was raised in rabbit using the middle region of Arsb as the immunogen
Purity:Min. 95%IL22 antibody
IL22 antibody was raised in rabbit using highly pure recombinant human IL-22 as the immunogen.Purity:Min. 95%DAGLB antibody
DAGLB antibody was raised using the middle region of DAGLB corresponding to a region with amino acids STAELFSTYFSDTDLVPSDIAAGLALLHQQQDNIRNNQEPAQVVCHAPGSPurity:Min. 95%TLE2 antibody
TLE2 antibody was raised in rabbit using the N terminal of TLE2 as the immunogen
Purity:Min. 95%Onecut 1 antibody
Onecut 1 antibody was raised in rabbit using the C terminal of Onecut 1 as the immunogenPurity:Min. 95%SLC1A2 antibody
SLC1A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKPurity:Min. 95%LRRTM1 antibody
LRRTM1 antibody was raised using the middle region of LRRTM1 corresponding to a region with amino acids RIFQDCRSLKFLDIGYNQLKSLARNSFAGLFKLTELHLEHNDLVKVNFAHPurity:Min. 95%NFAT5 antibody
NFAT5 antibody was raised in rabbit using the middle region of NFAT5 as the immunogenPurity:Min. 95%Man2a2 antibody
Man2a2 antibody was raised in rabbit using the N terminal of Man2a2 as the immunogenPurity:Min. 95%MAP3K7IP1 antibody
MAP3K7IP1 antibody was raised using the N terminal of MAP3K7IP1 corresponding to a region with amino acids MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEPurity:Min. 95%SLC38A3 antibody
SLC38A3 antibody was raised using the N terminal of SLC38A3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIMPurity:Min. 95%FGF basic antibody
FGF basic antibody was raised in rabbit using highly pure recombinant human FGF-basic as the immunogen.Purity:Min. 95%ATP2A1 antibody
ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLWPcdh11x antibody
Pcdh11x antibody was raised in rabbit using the middle region of Pcdh11x as the immunogen
Purity:Min. 95%Dhrs7 antibody
Dhrs7 antibody was raised in rabbit using the N terminal of Dhrs7 as the immunogen
Purity:Min. 95%Vps72 antibody
Vps72 antibody was raised in rabbit using the N terminal of Vps72 as the immunogenPurity:Min. 95%
