Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SYT16 antibody
SYT16 antibody was raised in rabbit using the N terminal of SYT16 as the immunogenPurity:Min. 95%YIPF2 antibody
YIPF2 antibody was raised in rabbit using the middle region of YIPF2 as the immunogen
Purity:Min. 95%MAP4K5 antibody
MAP4K5 antibody was raised using the middle region of MAP4K5 corresponding to a region with amino acids QGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILAPurity:Min. 95%CREG2 antibody
CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAHPurity:Min. 95%GPR161 antibody
GPR161 antibody was raised using the middle region of GPR161 corresponding to a region with amino acids FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSGPurity:Min. 95%MN1 antibody
The MN1 antibody is a powerful tool in Life Sciences research. It is a polyclonal antibody that specifically targets fibrinogen, an activated protein involved in blood clotting. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and ELISA assays. The MN1 antibody has been shown to effectively bind to virus surface antigens and neutralize their activity, making it a valuable tool for antiviral research. Additionally, this antibody has been used in mass spectrometric methods to identify and quantify chemokines and interferons in human serum samples. With its high specificity and affinity, the MN1 antibody is an essential component of any researcher's toolkit in the field of Life Sciences.Purity:Min. 95%POU5F1 antibody
POU5F1 antibody was raised in rabbit using the middle region of POU5F1 as the immunogenPurity:Min. 95%KCNK4 antibody
KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPurity:Min. 95%TMEM91 antibody
TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLPurity:Min. 95%IRX3 antibody
IRX3 antibody was raised in rabbit using the N terminal of IRX3 as the immunogenPurity:Min. 95%FBXW8 antibody
FBXW8 antibody was raised in rabbit using the middle region of FBXW8 as the immunogenPurity:Min. 95%GCSF antibody
GCSF antibody was raised in rabbit using highly pure recombinant human G-CSF as the immunogen.Purity:Min. 95%Urgcp antibody
Urgcp antibody was raised in rabbit using the N terminal of Urgcp as the immunogenPurity:Min. 95%CYP4V2 antibody
CYP4V2 antibody was raised using the middle region of CYP4V2 corresponding to a region with amino acids RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTIPurity:Min. 95%EVX2 antibody
EVX2 antibody was raised in rabbit using the middle region of EVX2 as the immunogen
Purity:Min. 95%WDSUB1 antibody
WDSUB1 antibody was raised in rabbit using the middle region of WDSUB1 as the immunogen
Purity:Min. 95%GTL3 antibody
GTL3 antibody was raised in rabbit using the C terminal of GTL3 as the immunogen
Purity:Min. 95%C14orf48 antibody
C14orf48 antibody was raised in rabbit using the N terminal of C14orf48 as the immunogenPurity:Min. 95%OR2J2 antibody
OR2J2 antibody was raised in rabbit using the C terminal of OR2J2 as the immunogenPurity:Min. 95%ZNF764 antibody
ZNF764 antibody was raised in rabbit using the N terminal of ZNF764 as the immunogen
Purity:Min. 95%
