Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
METTL1 antibody
METTL1 antibody was raised using the middle region of METTL1 corresponding to a region with amino acids KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
ID4 antibody
The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.
RTP4 antibody
RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
Desmocollin 1 antibody
Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.Chlamydia trachomatis antibody (FITC)
Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.
