Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
HS3ST5 antibody
HS3ST5 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH
Purity:Min. 95%SAMHD1 antibody
The SAMHD1 antibody is a highly specialized tool used in various assays and research applications. It specifically targets SAMHD1, an EGF-like glycoprotein involved in cellular processes. This antibody is designed to inhibit the activity of SAMHD1 and can be used as a valuable tool for studying its function.
D-dimer antibody
D-dimer antibody is a monoclonal antibody that specifically targets D-dimer, a protein fragment that is produced when blood clots are broken down. This antibody has antiviral properties and can neutralize the activity of D-dimer, preventing excessive blood clot formation. In addition to its therapeutic use, this antibody is also used in research and diagnostics in the field of Life Sciences. It can be used to study the role of D-dimer in various biological processes, such as wound healing and thrombosis. The formulation of this antibody includes excipients like histidine and insulin to ensure stability and enhance its efficacy.ZNF488 antibody
ZNF488 antibody was raised in rabbit using the C terminal of ZNF488 as the immunogen
Purity:Min. 95%Goat anti Human IgA (alpha chain) (FITC)
This antibody reacts with heavy chains on human IgA (alpha chain) and.
Methamphetamine antibody
Methamphetamine antibody was raised in mouse using methamphetamine-BSA as the immunogen.
Purity:Min. 95%IGF-1R antibody
The IGF-1R antibody is a powerful tool in the field of Life Sciences. It specifically targets the insulin-like growth factor-1 receptor, an important protein involved in cell growth and development. This antibody can be used in various research applications, including immunofluorescence, Western blotting, and immunohistochemistry.
Purity:Min. 95%DLG2 antibody
DLG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFFACYCALRTNVKKYRYQDEDAPHDHSLPRLTHEVRGPELVHVSEKNLSPurity:Min. 95%Prohibitin antibody
Prohibitin antibody was raised using the C terminal of PHB corresponding to a region with amino acids AEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLS
Purity:Min. 95%Rabbit anti Whole Bovine serum antibody (IgG fraction)
Whole bovine serum antibody (IgG fraction) was raised in rabbit using bovine serum as the immunogen.Purity:Min. 95%CD86 antibody (Spectral Red)
CD86 antibody (Spectral Red) was raised in rat using murine CD86 as the immunoge.
Purity:Min. 95%Chicken anti Rabbit IgG (H + L) (Alk Phos)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.Purity:Min. 95%CCNA2 antibody
CCNA2 antibody was raised in rabbit using the C terminal of CCNA2 as the immunogenPurity:Min. 95%RPA2 antibody
The RPA2 antibody is a highly specialized monoclonal antibody that has been extensively studied for its therapeutic potential in various conditions. It specifically targets calmodulin, a protein involved in many cellular processes. The RPA2 antibody has shown promising results in the treatment of heparin-induced thrombocytopenia, a condition characterized by low platelet count due to an immune reaction to heparin.
CD25 antibody (biotin)
CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.
Purity:Min. 95%SHP2 antibody
The SHP2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been extensively studied and proven to be effective in various applications. This antibody has the ability to bind to collagen, erythropoietin, TNF-related apoptosis-inducing ligand (TRAIL), autoantibodies, and disulfide bonds. It has also been shown to react with human serum proteins such as alpha-fetoprotein.
Purity:Min. 95%Lactoferrin antibody
Lactoferrin antibody was raised in Mouse using purified human lactoferrin as the immunogen.COL8A2 antibody
COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen
Purity:Min. 95%
