Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75560 products of "Primary Antibodies"
ST3GAL4 antibody
ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMPurity:Min. 95%C5ORF24 antibody
C5ORF24 antibody was raised using the middle region of C5Orf24 corresponding to a region with amino acids SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT
Biotin antibody
The Biotin antibody is a polyclonal antibody that specifically binds to biotin. It has a high affinity for biotin and can be used in various applications such as immunohistochemistry, Western blotting, and ELISA. This antibody is commonly used in life sciences research to detect and visualize biotinylated molecules or to amplify signals in assays. It can also be used in conjunction with streptavidin-conjugated enzymes or fluorochromes for detection purposes. The Biotin antibody is highly specific and sensitive, making it an essential tool for researchers working with biotinylation techniques or studying the role of biotin in biological processes.
Purity:Min. 95%Goat anti Rabbit IgG (H + L) (FITC)
This antibody reacts with heavy (gamma) chains on rabbit IgG and light chains on all rabbit immunoglobulins.
Purity:Min. 95%Annexin A4 antibody
Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ
Desmoglein 2 antibody
Desmoglein 2 antibody is a monoclonal antibody that specifically targets and neutralizes the growth factor Desmoglein 2. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in inhibiting the activity of Desmoglein 2. By blocking the action of this growth factor, Desmoglein 2 antibody can potentially prevent or reduce the proliferation of cells that are dependent on its signaling pathway.
LDB1 antibody
The LDB1 antibody is a powerful tool used in the field of life sciences. It is a polyclonal antibody that specifically targets the LDB1 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be highly effective in applications such as immunohistochemistry, Western blotting, and flow cytometry.
AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique studies on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
