Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
CXCL16 antibody
The CXCL16 antibody is a highly specialized monoclonal antibody that targets the chemokine CXCL16. It has been shown to have an inhibitory effect on the activation of this chemokine, making it a potential therapeutic option for various conditions. This antibody has also demonstrated an immobilization effect on steroids, further enhancing its potential in the field of life sciences.
Ubiquitin antibody (Prediluted for IHC)
Rabbit polyclonal Ubiquitin antibody (Prediluted for IHC)
Purity:Min. 95%PSMC5 antibody
PSMC5 antibody was raised in rabbit using the C terminal of PSMC5 as the immunogen
Purity:Min. 95%GJA1 antibody
The GJA1 antibody is a highly specific monoclonal antibody that targets oncostatin, a primary amino acid glycoprotein involved in various cellular processes. This antibody is widely used in Life Sciences research for studying the function and expression of GJA1. It can be utilized in various applications such as immunohistochemistry, Western blotting, and ELISA. The GJA1 antibody recognizes the cysteine disulfide region of the protein and exhibits high affinity and specificity. Researchers can also use polyclonal antibodies against GJA1 for further validation or as controls in their experiments. With its inhibitory factor properties, this antibody has potential applications in cancer research, specifically leukemia inhibitory factor studies. Its effectiveness has been demonstrated in human serum samples using electrode-based assays.
CD62E antibody
The CD62E antibody is a glycan-specific monoclonal antibody that is widely used in the field of life sciences. This antibody specifically recognizes and binds to glycosylation sites on proteins, glycoproteins, and glycopeptides. It has been extensively studied for its potential applications in various research areas, including immunology, cell biology, and biochemistry.AS3MT antibody
AS3MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.
FTSJ1 antibody
FTSJ1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGRTSKDKRDVYYRLAKENGWRARSAFKLLQLDKEFQLFQGVTRAVDLCA
Rabbit anti Chicken IgG (Alk Phos)
Rabbit anti-chicken IgG (Alk Phos) was raised in rabbit using chicken IgG F(c) fragment as the immunogen.
Purity:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%E2F4 antibody
The E2F4 antibody is a polyclonal antibody that has been shown to have apoptosis-inducing activity. It specifically targets the activated form of E2F4, an oncogenic kinase involved in cell proliferation and survival. This antibody can be used for immobilization in various life science applications, including research in the field of antibodies and growth factors. It is also effective as a monoclonal antibody against epidermal growth factor (EGF) inhibitors. The E2F4 antibody has been extensively studied and has shown high specificity and affinity for its target, making it a valuable tool for researchers in the field.
