Primary Antibodies

Affinity purified Rabbit polyclonal AP1S2 antibody

CYP20A1 antibody was raised in Rabbit using Human CYP20A1 as the immunogen

The ID4 antibody is a highly specialized product used in the field of Life Sciences. It is commonly employed in chromatographic techniques and immobilization processes. This antibody specifically targets angptl3, a growth factor protein involved in various biological processes such as collagen production and cell growth. The ID4 antibody is known for its neutralizing properties, effectively inhibiting the activity of angptl3 dimers.

The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.

The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.

MYLIP antibody was raised using the middle region of MYLIP corresponding to a region with amino acids CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE

Rabbit polyclonal MAP2K1/2 antibody (Ser218,222)

Affinity purified Rabbit polyclonal Cryopyrin antibody

NMB antibody was raised in Rabbit using Human NMB as the immunogen

The EGF antibody is a monoclonal antibody that specifically targets and neutralizes the activity of epidermal growth factor (EGF). This antibody is widely used in Life Sciences research for its ability to inhibit the binding of EGF to its receptor, preventing downstream signaling pathways that promote cell proliferation and survival. The EGF antibody can be immobilized on streptavidin-coated surfaces or used in solution-based assays. It has been shown to be cytotoxic towards cells that rely heavily on EGF signaling for their growth and survival. Additionally, this antibody has been used in studies to investigate the role of EGF in various biological processes, such as wound healing and cancer progression. With its high specificity and affinity for EGF, the EGF antibody is an invaluable tool for researchers studying the effects of this growth factor and developing potential therapeutic inhibitors.

The PIGR antibody is a highly specialized monoclonal antibody that targets the polymeric immunoglobulin receptor (PIGR). This receptor plays a crucial role in the transportation of antibodies across mucosal surfaces, such as those found in the respiratory and gastrointestinal tracts. The PIGR antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.

Affinity purified Rabbit polyclonal NDUFAB1 antibody

The RASGRP4 antibody is a highly effective medicament that targets the circumsporozoite protein. This antibody specifically binds to the activated form of the protein, which is located in the nucleus. It has been shown to inhibit the activity of VEGF-C, human chorionic gonadotropin, and other antigens involved in angiogenesis. The RASGRP4 antibody can be used in immunohistochemistry studies to detect and visualize these proteins in various tissues. This product is a polyclonal antibody, meaning it is derived from multiple sources and provides a broad range of specificity. It is widely used in life sciences research to study endothelial growth factors and their role in various biological processes. With its high-quality performance and reliable results, this antibody is an essential tool for scientists and researchers working in the field of molecular biology.

Pneumocystis carinii antibody was raised in mouse using Pneumocystis carinii isolates as the immunogen.

FOXG1A antibody was raised using the N terminal of FOXG1A corresponding to a region with amino acids GAPEGQRQLAQGDRRGRGICPVGPDEKEKARAGGEEKKGAGEGGKDGEGG

Chondroitin-6 sulfate antibody was raised in mouse using chondroitinase ABC-digested adult human aggrecan as the immunogen.

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the rifamycin class. It is known for its bactericidal activity against tuberculosis infection. By binding to DNA-dependent RNA polymerase, it inhibits bacterial growth, preventing transcription and replication. This drug has been extensively studied and shown to be highly effective using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.

CXCL3 antibody was raised in Rabbit using Human CXCL3 as the immunogen

The HSL antibody is a monoclonal antibody that specifically targets and inhibits the activity of phosphatase enzymes. This antibody is widely used in Life Sciences research to study the role of phosphatases in various cellular processes. It has been shown to effectively block the activity of phosphatases involved in signal transduction pathways, such as those activated by growth factors and cytokines like TNF-α and chemokines.