Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75459 products of "Primary Antibodies"
ACTL6B antibody
ACTL6B antibody was raised using the middle region of ACTL6B corresponding to a region with amino acids GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS
Laminin antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an effective antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infection and contains active compounds that exhibit strong bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. It has been extensively tested using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.CD24 antibody (Spectral Red)
CD24 antibody (Spectral Red) was raised in rat using murine heat stable antigen as the immunogen.
Purity:Min. 95%C1QTNF4 antibody
C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
Purity:Min. 95%GLYT1 antibody
GLYT1 antibody was raised in rabbit using a 20 amino acid peptide of rat GLYT1 as the immunogen.Purity:Min. 95%Estrogen Receptor alpha antibody (Ser106)
Rabbit Polyclonal Estrogen Receptor alpha antibody (Ser106)
TRAIL antibody
TRAIL antibody was raised in mouse using highly pure recombinant human TRAIL/APO-II as the immunogen.
Tetraspanin 17 antibody
Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWIPurity:Min. 95%IGFBP2 antibody
The IGFBP2 antibody is a cytotoxic monoclonal antibody that is used in various applications in the field of Life Sciences. It is specifically designed to target and neutralize IGFBP2, a protein involved in cellular processes such as cell growth and proliferation. This antibody has been shown to be highly effective in inhibiting the activity of IGFBP2, making it a valuable tool for researchers studying the role of this protein in different biological systems.
MMAB antibody
The MMAB antibody is an activated Monoclonal Antibody that is commonly used in Life Sciences research. It specifically targets insulin, a hormone involved in regulating blood sugar levels. This antibody can be used for various applications, including immunohistochemistry and the detection of interleukin-6 (IL-6) levels. The MMAB antibody has cytotoxic properties, meaning it can selectively kill cells expressing the target protein. Additionally, it has been shown to interact with other proteins such as butyrylcholinesterase, TRPV4, and actin. With its high specificity and affinity for its target, the MMAB antibody is a valuable tool for studying insulin-related processes and their implications in various diseases and disorders.PGD antibody
The PGD antibody is a powerful tool used in Life Sciences research. It specifically targets 6-phosphogluconate dehydrogenase (PGD), an enzyme involved in the pentose phosphate pathway. This antibody recognizes and binds to PGD, allowing researchers to study its function and regulation.
