Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
DDX24 antibody
The DDX24 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically binds to nuclear binding proteins. This monoclonal antibody is highly activated and can be used for various applications in research and medicine.
FZD8 antibody
The FZD8 antibody is a diagnostic reagent that plays a crucial role in the field of Life Sciences. It is an antigen-specific antibody that specifically targets and binds to the FZD8 protein. This antibody is widely used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.
FTCD antibody
FTCD antibody was raised using the N terminal of FTCD corresponding to a region with amino acids FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
Troponin T antibody (Cardiac)
Troponin T antibody (cardiac) was raised in mouse using free human cTnT as the immunogen.C20ORF3 antibody
C20ORF3 antibody was raised using the C terminal Of C20Orf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL
Testosterone 3 antibody
Testosterone 3 antibody was raised in rabbit using testosterone-3 BSA as the immunogen.
Cytokeratin 10 antibody
Cytokeratin 10 antibody is a collagen-based product that is used in Life Sciences research. This antibody has antiviral properties and can be used in experiments involving electrodes. It is a monoclonal antibody that has neutralizing effects on certain growth factors. Cytokeratin 10 antibody can be used in the detection of specific proteins in human serum, such as fibrinogen, anti-mesothelin, and alpha-fetoprotein. It can also be used as an activated inhibitor in various assays and experiments. With its high specificity and effectiveness, this antibody is a valuable tool for researchers in the field of Life Sciences.
Donkey anti Sheep IgG (H + L) (HRP)
This antibody reacts with heavy (gamma) chains on sheep IgG and light chains on all sheep immunoglobulins.Purity:Min. 95%
