Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,793 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
NP antibody
<p>The NP antibody is a monoclonal antibody that specifically targets antiphospholipid antibodies. It is designed to recognize and bind to glycopeptides and glycoproteins associated with these autoantibodies. The NP antibody has cytotoxic properties and can be used for various applications in research and diagnostics.</p>p53 antibody
<p>The p53 antibody is a protein that specifically targets and binds to the p53 protein, which plays a crucial role in cell cycle regulation and tumor suppression. This antibody can be used in various research applications, including immunohistochemistry, western blotting, and flow cytometry.</p>GATA3 antibody
<p>The GATA3 antibody is a highly specific and potent monoclonal antibody that targets the GATA3 protein. This protein is involved in various cellular processes, including the regulation of gene expression and cell differentiation. The GATA3 antibody has been extensively studied for its role in cancer research, particularly in breast cancer.</p>STAT3 antibody
<p>The STAT3 antibody is a highly specialized protein complex that specifically targets and neutralizes the activated form of the STAT3 protein. It is available in both polyclonal and monoclonal antibody forms, providing researchers with options for their specific experimental needs.</p>Cytokeratin 18 antibody
<p>Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF</p>KCNRG antibody
<p>KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids VDRDGDLFSFILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNP</p>
