Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,550 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Tetanus toxin antibody
Tetanus toxin antibody is a monoclonal antibody that acts as an inhibitor of the tetanus toxin. It belongs to the class of antibodies known as neutralizing antibodies, which are active agents in the field of life sciences. This monoclonal antibody specifically targets and neutralizes the effects of tetanus toxin by binding to it and preventing it from causing harm. Additionally, this antibody has been shown to have potential therapeutic applications in other areas, such as inhibiting the activity of epidermal growth factor (EGF) and atypical hemolytic autoantibodies. With its versatility and efficacy, this monoclonal antibody offers promising possibilities for medical research and treatment options.
Purity:>92% By Gel Electrophoresis And Gel ScanningARC antibody
The ARC antibody is a highly specialized antibody that has numerous characteristics and applications in the field of Life Sciences. It is an autoantibody that specifically targets adenine, a crucial molecule involved in various biological processes. The ARC antibody has been extensively studied for its ability to inhibit the growth factor β-catenin, which plays a crucial role in cell proliferation and differentiation.
MTGR1 antibody
MTGR1 antibody was raised in Rat using MTGR1 peptide couple to carrier protein as the immunogen.
DPY19L4 antibody
DPY19L4 antibody was raised using a synthetic peptide corresponding to a region with amino acids APVAAVFAGSPQLMGAIKLCTGWMVTSLPLYNDDDLLKRNENIYQIYSKR
Purity:Min. 95%
