Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
CYP1A1 antibody
The CYP1A1 antibody is a highly specific antibody that targets the cytochrome P450 1A1 enzyme. This enzyme plays a crucial role in the metabolism of various drugs and toxins in the body. The CYP1A1 antibody can be used in various research applications, including Western blotting, immunohistochemistry, and enzyme-linked immunosorbent assay (ELISA). It has been extensively validated for its specificity and sensitivity.
VIM antibody
The VIM antibody is a monoclonal antibody that targets the interleukin-6 (IL-6) chemokine. It specifically binds to galectin-3-binding protein (LGALS3BP), which plays a crucial role in various biological processes, including cell growth and proliferation. The VIM antibody can be used in research applications to study protein-protein interactions and investigate the function of LGALS3BP in different cellular pathways.
CD24 antibody (Azide Free)
CD24 antibody (Azide Free) was raised in rat using murine heat stable antigen as the immunogen.
GPR20 antibody
GPR20 antibody was raised in rabbit using a synthetic peptide conjugated to KLH as the immunogen.
Purity:Min. 95%TAZ antibody
TAZ antibody was raised in rabbit using residures 386-400 [VESALNKSEPFLTWL] of the 49kDa human TAZ protein as the immunogen.
Purity:Min. 95%SERINC2 antibody
SERINC2 antibody was raised using the N terminal of SERINC2 corresponding to a region with amino acids VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSS
Purity:Min. 95%YAP1 antibody
The YAP1 antibody is a polyclonal antibody that specifically targets the YAP1 protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The YAP1 antibody is designed to recognize and bind to the YAP1 protein, allowing for its detection and analysis in biological samples.
Bin1 antibody
Bin1 antibody was raised in rabbit using the N terminal of Bin1 as the immunogen
Purity:Min. 95%HSPA1A antibody
The HSPA1A antibody is a monoclonal antibody that specifically targets the glycoprotein HSPA1A. This antibody has been shown to have multiple functions, including its ability to inhibit interferon and leukemia inhibitory factor signaling pathways. Additionally, it has been found to have antiphospholipid antibodies and antiviral activity. The HSPA1A antibody also acts as an inhibitor of dopamine release and exhibits cytotoxic effects on certain hormone peptides. Furthermore, it has been used as an anticoagulant in human serum and has been shown to target autoantibodies. With its diverse range of functions, the HSPA1A antibody holds great potential for various therapeutic applications.
