Primary Antibodies

Factor VIII antibody is a monoclonal antibody that targets sclerostin, an epidermal growth factor. It is commonly used in Life Sciences research as a tool to study the role of sclerostin in bone metabolism and growth. This antibody has been shown to be highly specific and effective in neutralizing the activity of sclerostin, leading to increased bone formation and density. Factor VIII antibody can also be used as a cytotoxic agent in certain applications, such as targeted therapy for cancer cells that express high levels of sclerostin. Additionally, this antibody can be conjugated to various biomaterials or used in combination with other antibodies for specific research purposes. Its unique properties make it a valuable tool for studying the effects of sclerostin on bone health and development.

The HA antibody is a high-quality polyclonal antibody that is widely used in life sciences research. It is specifically designed to target and neutralize the catalase enzyme, which plays a crucial role in various biological processes. This antibody exhibits strong catalase activity and has been shown to effectively inhibit the reactive properties of catalase. Additionally, it can bind to streptavidin and other peptide agents, making it versatile for use in different experimental setups. The HA antibody is water-soluble and can be easily incorporated into various assays and experiments. It is commonly used to detect and measure antiphospholipid antibodies in human serum samples, making it an essential tool for autoimmune disease research. With its high specificity and affinity, this monoclonal antibody ensures reliable results in any scientific investigation requiring the detection or neutralization of catalase or other related enzymes.

Rabbit Polyclonal Synuclein antibody (Ser129)

ALDH3A2 antibody was raised in Rabbit using Human ALDH3A2 as the immunogen

CRISPR/Cas9 Monoclonal Antibody (HRP)

Affinity purified Rabbit polyclonal XRCC2 antibody

The Agrin antibody is a highly specialized monoclonal antibody that targets the Agrin protein. This protein is found in human serum and plays a crucial role in various cellular processes, including colony-stimulating and actin filament formation. The Agrin antibody has been extensively tested and proven to have neutralizing effects on the Agrin protein, effectively blocking its activity. One of the key features of the Agrin antibody is its ability to specifically bind to the Agrin protein, preventing it from interacting with its receptors. This targeted binding ensures that the toxic effects of excessive Agrin activity are minimized. Additionally, the Agrin antibody has shown promising results in inhibiting the growth and migration of cells that rely on Agrin signaling for their function. In addition to its neutralizing properties, the Agrin antibody has also been used as a research tool in various studies involving cell biology and molecular biology. It has been utilized in experiments investigating the role of Agrin in different biological processes, such as embryonic development

Please enquire for more information about Anti-HIV P24 monoclonal antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.

Please enquire for more information about Murine Anti-HIV-1 p24 monoclonal Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page

SAA4 antibody was raised using the middle region of SAA4 corresponding to a region with amino acids AAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRF

HIST1H1C antibody was raised in Rabbit using Human HIST1H1C as the immunogen

The PZP antibody is a monoclonal antibody that targets taxol and oncostatin, which are growth factors involved in various biological processes. This antibody specifically binds to the CD33 antigen, making it an effective tool for research and therapeutic applications. Monoclonal antibodies like the PZP antibody are widely used in the field of life sciences for their ability to selectively target and inhibit specific molecules or pathways. The PZP antibody can be used in hybridization experiments, as well as in the development of inhibitors or activators for CD33-related signaling pathways. It is a valuable tool for researchers studying annexin or collagen-related processes. Whether you're conducting basic research or developing new therapies, the PZP antibody is an essential component in your scientific toolkit.

This antibody reacts with heavy chains on human IgG (gamma chain).

The CD105 antibody is a monoclonal antibody that is used in various applications related to angiogenesis and antiangiogenic therapy. It specifically targets CD105, also known as endoglin, which is a marker for microvessel density. The CD105 antibody works by binding to the antigen and forming an antigen-antibody complex, which can be detected using different techniques such as fluorescence immunochromatography or polymerase chain reaction (PCR). This specific antibody has been shown to be effective in detecting angiogenic factors and autoantibodies in human serum samples. Its high specificity and sensitivity make it a valuable tool for research and clinical diagnostics.

Affinity purified Rabbit polyclonal FMO3 antibody

The PAD4 antibody is a highly specialized medicament used in the field of Life Sciences. It is an acidic, EGF-like glycoprotein that plays a crucial role in various biological processes. This antibody is particularly known for its ability to neutralize and inhibit the activity of glial fibrillary acidic protein (GFAP), which is found predominantly in adipocytes.

IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV

COL8A2 antibody was raised in rabbit using the C terminal of COL8A2 as the immunogen

The IGF2BP2 antibody is a highly specialized antibody that targets the transferrin receptor in the nucleus of cells. This antibody is widely used in Life Sciences research to study various cellular processes, including exocytosis, cell signaling, and protein synthesis. The IGF2BP2 antibody specifically binds to the antigen on the cell surface and facilitates the internalization of transferrin into the cell. This process is crucial for proper iron metabolism and cellular homeostasis. Additionally, this monoclonal antibody has been shown to have antimicrobial properties against certain bacteria, such as those expressing alpha-gal epitopes. Its unique mechanism of action involves targeting bacterial phosphatases and inhibiting their activity, leading to impaired bacterial growth. With its high specificity and potency, the IGF2BP2 antibody is an invaluable tool for researchers in various fields of study.