
Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(3,955 products)
- Amino Acid and Amino Acid Related Compounds(3,466 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38249 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ACTH (4-10) trifluoroacetate salt
CAS:<p>ACTH (4-10) trifluoroacetate salt is a cholinergic agent that belongs to the class of neurotransmitters. It is synthesized from the naturally occurring hormone ACTH, which is released by the anterior pituitary gland in response to a variety of stimuli. This compound has been shown to have physiological effects on various organs, including adipose tissue and locomotor activity. It also shows neuroprotective effects in animal models and has neurotrophic properties. The therapeutic potential of this compound for brain functions is currently being explored.</p>Formula:C44H59N13O10SPurity:Min. 95%Molecular weight:962.09 g/molN-Methyl-2-fluoro-4-aminobenzamide
CAS:<p>N-Methyl-2-fluoro-4-aminobenzamide is a toxic compound that is commonly used as a reagent in chemical synthesis and research. It has been studied for its potential use in medicine, particularly in the treatment of castration-resistant prostate cancer. N-Methyl-2-fluoro-4-aminobenzamide acts as a nucleophilic agent, participating in reactions that involve the addition of an acyl group to a target molecule. Its stable formyl group allows for efficient reaction yields and reliable results. However, due to its toxic nature, caution must be exercised when handling this compound.</p>Formula:C8H9FN2OPurity:Min. 95%Molecular weight:168.17 g/mol2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol
CAS:<p>2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol is an impurity in hexane that is generated during the reaction of pyridine with acetonitrile. The impurity is removed by crystallizing it from methanol. 2-(4-Methyl-2-phenyl-1-piperazinyl)-3-pyridinemethanol has a high efficiency, and can be used to synthesize hexamethyldisiloxane. This product can be used as a metal catalyst for reactions involving alkali metals or metal halides. It can also be used as an alcohol solvent, but not hydrogenated.</p>Formula:C17H21N3OPurity:Min. 95%Color and Shape:White to off white powderMolecular weight:283.37 g/molFmoc-Asn(Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Fmoc-Tyr-Ala-diazomethylketone
CAS:<p>Please enquire for more information about Fmoc-Tyr-Ala-diazomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H26N4O5Purity:Min. 95%Molecular weight:498.53 g/mol5-Iodo-2-methoxybenzyl alcohol
CAS:<p>5-Iodo-2-methoxybenzyl alcohol (5IMB) is a conjugate that inhibits tubulin polymerization and mitochondrial membrane integrity. It has significant inhibitory effects on colchicine-induced apoptosis in colon cancer cells, inducing apoptotic cell death by the activation of caspase 3 and annexin. 5IMB also has an inhibitory effect on mitochondria, leading to mitochondrial membrane depolarization and apoptotic cell death. This conjugate also induces the death of human cancer cells, specifically mcf-7, which are involved in tumour growth and metastasis. The mechanism of action for 5IMB is through its ability to induce mitochondrial membrane depolarization, leading to apoptotic cell death.</p>Formula:C8H9O2IPurity:Min. 95%Molecular weight:264.06 g/molNeuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt
<p>Please enquire for more information about Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C205H310N58O61S2Purity:Min. 95%Molecular weight:4,627.14 g/mol4,6-Dichloro-2-methylnicotinic acid
CAS:<p>Please enquire for more information about 4,6-Dichloro-2-methylnicotinic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt
CAS:<p>H-Gly-Arg-Gly-Asp-D-Ser-Pro-OH trifluoroacetate salt (HGGDS) is a collagen gel that is used in the treatment of autoimmune diseases, such as arthritis and lupus. HGGDS inhibits the production of fibrinogen, which is a protein involved in blood clotting, by binding to its receptor on human fibroblasts. It also inhibits the production of basic proteins needed for the generation of collagen and activation of integrin receptors, which are involved in cell adhesion and migration. HGGDS also blocks transcription polymerase chain reactions (PCRs), which are necessary for the synthesis of DNA. This can lead to a decrease in cell proliferation and an increase in apoptosis.</p>Formula:C22H37N9O10Purity:Min. 95%Molecular weight:587.58 g/molLHRH (4-10) acetate salt
CAS:<p>Please enquire for more information about LHRH (4-10) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H53N11O9Purity:Min. 95%Molecular weight:747.84 g/molH-Met-Arg-OH acetate salt
CAS:<p>H-Met-Arg-OH acetate salt is a metabolite of the amino acid L-methionine. It is also a dipeptide, which consists of two amino acids that are linked by an amide bond. The linkage between the amino acids in this compound is clockwise instead of the usual left to right orientation. This means that H-Met-Arg-OH acetate salt is not an essential amino acid and can be synthesized by the body. Salmonella typhimurium uses H-Met-Arg-OH acetate salt as a precursor for its synthesis of L-arginine and L-methionine, which are essential to bacterial growth and survival. Residues have been found in foods such as milk and eggs, and it has been shown that cotransduction can lead to resistance against antibiotics such as streptomycin and tetracycline.</p>Formula:C11H23N5O3SPurity:Min. 95%Molecular weight:305.4 g/molPrepro VIP (156-170) (human)
CAS:<p>Please enquire for more information about Prepro VIP (156-170) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C71H106N16O31Purity:Min. 95%Molecular weight:1,679.69 g/molZ-Phe-Phe-diazomethylketone
CAS:<p>Z-Phe-Phe-diazomethylketone is a cathepsin inhibitor that has been shown to inhibit the proteolytic activity of various enzymes, including serine proteases and thrombotic thrombocytopenic. This compound inhibits the growth of Leishmania parasites in cell culture and has been shown to have a high affinity for carboxy terminal and proximal tubules. Z-Phe-Phe-diazomethylketone has a neutral pH, with an optimum at 7.0, which may be due to its ability to bind to proteins or other components of cells without affecting their functions.</p>Formula:C27H26N4O4Purity:Min. 95%Molecular weight:470.52 g/molOsteoblast Activating Peptide (human) trifluoroacetate salt
<p>Please enquire for more information about Osteoblast Activating Peptide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C120H196N38O37SPurity:Min. 95%Molecular weight:2,795.14 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Formula:C28H34N4O7SPurity:Min. 95%Molecular weight:570.66 g/molVIP (3-28) (human, mouse, rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP (3-28) (human, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C138H226N40O39SPurity:Min. 95%Molecular weight:3,101.58 g/molMinigastrin I tifluoroacetic acid
CAS:<p>Please enquire for more information about Minigastrin I tifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C74H99N15O26S•(CF3CO2H)xPurity:Min. 95%Molecular weight:1,646.73 g/molUroguanylin Topoisomer B (human) trifluoroacetate salt
<p>Please enquire for more information about Uroguanylin Topoisomer B (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C64H102N18O26S4Purity:Min. 95%Molecular weight:1,667.86 g/mol(Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt
CAS:Controlled Product<p>Please enquire for more information about (Des-Gly10,D-Tyr5,D-Ser(tBu)6,Pro-NHEt 9)-LHRH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C60H86N16O13Purity:Min. 95%Molecular weight:1,239.42 g/molBoc-D-Phe-Pro-OSu
CAS:<p>Please enquire for more information about Boc-D-Phe-Pro-OSu including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C23H29N3O7Purity:Min. 95%Molecular weight:459.49 g/molZ-Val-Gly-Arg-pNA acetate salt
CAS:<p>Please enquire for more information about Z-Val-Gly-Arg-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C27H36N8O7Purity:Min. 95%Molecular weight:584.62 g/molFA-Gly-Val-NH2
CAS:<p>Please enquire for more information about FA-Gly-Val-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Formula:C8H7BrO2Purity:Min. 95%Color and Shape:PowderMolecular weight:215.04 g/molEGF Receptor (988-993) (phosphorylated) (human)
CAS:<p>Please enquire for more information about EGF Receptor (988-993) (phosphorylated) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H46N7O16PPurity:Min. 95%Molecular weight:803.71 g/molAcetyl-Cholecystokinin Octapeptide (2-8) (sulfated)
CAS:<p>Please enquire for more information about Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C47H59N9O14S3Purity:Min. 95%Molecular weight:1,070.22 g/molN-Methyl-DL-alanine
CAS:<p>N-Methyl-DL-alanine is an amino acid that is also known as d-alanine. It is a precursor for the synthesis of other amino acids such as histidine, methionine, and arginine. N-Methyl-DL-alanine is found in the mitochondria of cells and plays a role in energy metabolism. It has been shown to be taken up by cells through an active transport process and can act as a competitive inhibitor of mitochondrial uptake. At physiological concentrations, N-methyl DL-alanine inhibits fatty acid oxidation by decreasing the activity of carnitine palmitoyltransferase I (CPT I) and enhancing lipid accumulation in the liver. N-Methyl DL-alanine has been shown to inhibit cycloleucin A production by acting as an inhibitor of fatty acid synthase (FAS).</p>Formula:C4H9NO2Purity:Min. 95%Color and Shape:White PowderMolecular weight:103.12 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C34H51N11O7•C2HF3O2Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:839.86 g/molH-Gly-Gly-Arg-Ala-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Arg-Ala-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C13H25N7O5Purity:Min. 95%Molecular weight:359.38 g/mol(H-Cys-4MbNA)2 acetate salt (Disulfide bond)
CAS:<p>Please enquire for more information about (H-Cys-4MbNA)2 acetate salt (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H30N4O4S2Purity:Min. 95%Molecular weight:550.69 g/molZ-Phe-Cit-AMC
CAS:<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>Formula:C33H35N5O7Purity:Min. 95%Molecular weight:613.66 g/molBoc-Arg(Tos)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%H-Lys-Ala-pNA·2 HCl
CAS:<p>Please enquire for more information about H-Lys-Ala-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H23N5O4·2HClPurity:Min. 95%Molecular weight:410.3 g/mol(Val6,Ala7)-Kemptide
CAS:<p>Please enquire for more information about (Val6,Ala7)-Kemptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H61N13O9Purity:Min. 95%Molecular weight:771.91 g/molBoc-D-Asn-ONp
CAS:<p>Please enquire for more information about Boc-D-Asn-ONp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H19N3O7Purity:Min. 95%Molecular weight:353.33 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C149H218N42O47SPurity:Min. 95%Molecular weight:3,381.65 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20N4O4Purity:Min. 95%Molecular weight:332.35 g/mol(Ile3)-Pressinoic acid
CAS:<p>Ile3-pressinoic acid is an amide that is structurally similar to gamma-aminobutyric acid. It has dose-dependent effects on fatty acid synthesis and redox potential. Ile3-pressinoic acid is a leishmania molecule that can be used as a diagnostic agent for the disease, as well as a potential treatment in cell culture and animal models. It also has been shown to have receptor activity on peptide hormones, including oxytocin receptors.</p>Formula:C30H44N8O10S2Purity:Min. 95%Molecular weight:740.85 g/molBoc-Thr(Val-Fmoc)-OH
CAS:<p>Please enquire for more information about Boc-Thr(Val-Fmoc)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H36N2O8Purity:Min. 95%Molecular weight:540.6 g/molAc-Asp-Glu-Val-Asp-aldehyde (pseudo acid)
CAS:<p>Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) is a pro-apoptotic protein that belongs to the group of pseudo acids. It is able to induce apoptosis. Ac-Asp-Glu-Val-Asp-aldehyde (pseudo acid) can induce neuronal death by activating caspases and apoptosis pathway, which are involved in the process of programmed cell death. This protein also has anti-inflammatory properties, which may be due to its ability to inhibit cyclase activity. Ac-Asp-Glu-Val-Asp (pseudo acid) has been shown to be present at physiological levels in the brain and heart, where it may play an important role in maintaining cell viability.</p>Formula:C20H30N4O11Purity:Min. 95%Molecular weight:502.47 g/molAngiotensin I-Converting Enzyme (ACE) Inactivator Cyanoac-Phe-Phe-OH
CAS:<p>Cyanoac-Phe-Phe-OH is a hydrolytic enzyme that irreversibly inactivates the ACE enzyme. It acts as an inhibitor of angiotensin-converting enzyme and inhibits the conversion of angiotensin I to angiotensin II, which is involved in blood pressure regulation. Cyanoac-Phe-Phe-OH has been shown to be more potent than captopril, another ACE inhibitor. It also has a longer half life and greater selectivity for ACE over other serine proteases.</p>Formula:C21H21N3O4Purity:Min. 95%Molecular weight:379.41 g/molFA-Gly-Leu-NH2
CAS:<p>FA-Gly-Leu-NH2 is an amide that inhibits the activity of metalloproteases by binding to the zinc ion in the active site. It was shown to inhibit protease activity and protein synthesis in armillaria. This compound also showed irreversible inhibition of thermolysin, a serine protease, and protein synthesis in yeast. The biological properties of FA-Gly-Leu-NH2 were studied using a synthetic substrate for thermolysin, which led to the conclusion that this inhibitor has potential as a therapeutic agent for inflammatory diseases.</p>Formula:C15H21N3O4Purity:Min. 95%Molecular weight:307.35 g/molPAR-2 (1-6) amide (human) trifluoroacetate salt
CAS:<p>PAR-2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val-NH2 trifluoroacetate salt is a protease inhibitor that inhibits the activity of PAR2, a protein receptor. PAR2 is implicated in cancer and inflammation. It has been shown to inhibit growth factor signaling, as well as activate toll-like receptor 4 and other inflammatory pathways. PAR2 inhibition has also been studied in vivo and found to be effective in treating wild type mice with melanoma cells. In vitro studies have shown that PAR2 inhibition by PAR 2 (1-6) amide (human) trifluoroacetate salt H-Ser-Leu-Ile-Gly-Lys-Val NH2 trifluoroacetate salt blocks the production of tumour necrosis factor alpha and interleukin 6.</p>Formula:C28H54N8O7Purity:Min. 95%Molecular weight:614.78 g/molpTH (13-34) (human)
CAS:<p>Please enquire for more information about pTH (13-34) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C125H199N39O33SPurity:Min. 95%Molecular weight:2,808.23 g/mol(S)-β-methyl-γ-butyrolactone
CAS:<p>(S)-Beta-methyl-gamma-butyrolactone is a synthetic vitamin D2 that is used in the synthesis of calciferol. It is also used for the stereospecific synthesis of 25-hydroxyvitamin D3, which is an active metabolite of vitamin D2. The compound has been found to be effective against rickets, hypocalcemia, and osteomalacia. (S)-beta-methyl-gamma-butyrolactone has shown optical activity and can be used as a chiral auxiliary in the syntheses of vitamin A, retinoids, and other drugs that require optically pure starting materials.</p>Formula:C5H8O2Purity:Min. 95%Color and Shape:Clear LiquidMolecular weight:100.12 g/mol1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid
CAS:<p>Please enquire for more information about 1-{[5-(Cyclopropylcarbonyl)-1-methyl-4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridin-3-yl]carbonyl}piperidine-4-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H24N4O4Purity:Min. 95%Molecular weight:360.41 g/molDibenzoyl-(-)-p-methoxy-L-tartaric acid
CAS:<p>Dibenzoyl-(-)-p-methoxy-L-tartaric acid is a chiral compound that has been extracted from plants and synthesized. It has a bitter taste and can be used as an enantiomer to treat schistosomiasis, a disease caused by parasitic flatworms. Dibenzoyl-(-)-p-methoxy-L-tartaric acid can be used as an enantiomer to treat schistosomiasis, which is caused by parasitic flatworms. The chemical is an anionic β-cyclodextrin derivative that binds to the parasites in the host's body and prevents them from releasing eggs into the water supply. This chemical also has pharmacological properties, such as antiinflammatory activities.</p>Formula:C20H18O10Purity:Min. 95%Color and Shape:White PowderMolecular weight:418.35 g/molp-Methoxybenzylmercaptan
CAS:<p>P-Methoxybenzylmercaptan is an inhibitor of protein synthesis. It binds to the active site of the enzyme ribonuclease A, which is involved in the processing of messenger RNA. P-Methoxybenzylmercaptan also inhibits other enzymes such as alkaline phosphatase and esterases. It has been shown to be effective against HIV infection. This compound can be used for chemical ligation reactions and as a cell culture medium additive, as it protects cells from oxidation and provides a more acidic environment. P-Methoxybenzylmercaptan has been shown to bind to amines and is being investigated for its use in drug development.</p>Formula:C8H10OSPurity:Min. 95%Color and Shape:Clear LiquidMolecular weight:154.23 g/molTRAP-14 amide trifluoroacetate salt
CAS:<p>Please enquire for more information about TRAP-14 amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C81H119N21O22Purity:Min. 95%Molecular weight:1,738.94 g/molAc-p-amino-Phe-OMe
CAS:<p>Please enquire for more information about Ac-p-amino-Phe-OMe including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C12H16N2O3Purity:Min. 95%Molecular weight:236.27 g/molH-Ile-Ile-Ile-OH acetate salt
CAS:<p>Please enquire for more information about H-Ile-Ile-Ile-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H35N3O4Purity:Min. 95%Molecular weight:357.49 g/molFmoc-D-Arg(Pmc)-OPfp
CAS:<p>Please enquire for more information about Fmoc-D-Arg(Pmc)-OPfp including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H41F5N4O7SPurity:Min. 95%Molecular weight:828.85 g/molAc-D-Ala-D-lactic acid
CAS:<p>Please enquire for more information about Ac-D-Ala-D-lactic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H13NO5Purity:Min. 95%Molecular weight:203.19 g/molAngiogenin (108-123)
CAS:<p>Please enquire for more information about Angiogenin (108-123) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C83H132N26O24Purity:Min. 95%Molecular weight:1,878.1 g/molH-Ala-Tyr-Ala-OH
CAS:<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>Formula:C15H21N3O5Purity:Min. 95%Molecular weight:323.34 g/molH-Val-Pro-OtBu·HCl
CAS:<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H26N2O3·HClPurity:Min. 95%Molecular weight:306.83 g/molVIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt
CAS:<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C50H77N9O12SPurity:Min. 95%Molecular weight:1,028.27 g/molAngiotensin I (1-9) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C56H78N16O13Purity:Min. 95%Molecular weight:1,183.32 g/molH-D-Arg-Arg-Pro-Hyp-Gly-β-(2-thienyl)-Ala-Ser-D-Phe-b-(2-thienyl)-Ala-Arg-OH
CAS:<p>Enalaprilat is a prodrug that is converted to the active drug enalapril in vivo. It is a potent angiotensin-converting enzyme (ACE) inhibitor that prevents the conversion of angiotensin I to angiotensin II, which leads to vasodilatation and reduced blood pressure. Enalaprilat has been shown to be effective in lowering blood pressure in patients with cardiac insufficiency or hypertension. It also has been shown to decrease the production of endogenous bradykinin, which acts on its receptor B2, leading to vasodilatation and reduced blood pressure. The most common side effect of enalaprilat therapy is cutaneous reactions such as erythema, rash, or pruritus.</p>Formula:C56H83N19O13S2Purity:Min. 95%Molecular weight:1,294.51 g/molC-Peptide 2 (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about C-Peptide 2 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C135H222N38O49Purity:Min. 95%Molecular weight:3,161.43 g/molZ-Gly-Gly-Leu-AMC
CAS:<p>Z-Gly-Gly-Leu-AMC is a small molecule that inhibits the activity of certain enzymes, such as poly (ADP-ribose) polymerase (PARP), which are involved in DNA repair and DNA replication. It has been shown to be effective against cancer cells and is used for the treatment of various cancers, including breast cancer. Z-Gly-Gly-Leu-AMC has also been shown to have anti-inflammatory properties and may be useful for the treatment of autoimmune diseases. The drug binds to PARP, inhibiting its ability to interact with other proteins, thereby preventing activation of proapoptotic protein.</p>Formula:C28H32N4O7Purity:Min. 95%Molecular weight:536.58 g/molZ-Trp-Val-OH trifluoroacetic acid
CAS:<p>Please enquire for more information about Z-Trp-Val-OH trifluoroacetic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C24H27N3O5•CF3CO2HPurity:Min. 95%Molecular weight:437.49 g/molFA-Gly-Nva-NH2
CAS:<p>Please enquire for more information about FA-Gly-Nva-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H19N3O4Purity:Min. 95%Molecular weight:293.32 g/molH-Ser-Leu-OH
CAS:<p>H-Ser-Leu-OH is a methylvaleric acid that is found in biological tissue and has been studied for its potential use as a pharmacological treatment. It has been shown to have anti-inflammatory effects, which may be due to its inhibition of prostaglandin synthesis. H-Ser-Leu-OH also inhibits the activity of divalent metal ions, such as magnesium and zinc, by binding to their chelating groups. This binding prevents the formation of an enzyme cell wall synthesis complex with the enzyme that is required for cell wall biosynthesis, inhibiting protein synthesis and cell division. H-Ser-Leu-OH has also shown potential as an analytical method for cancer detection. It can be used to detect carcinogenesis by detecting changes in DNA methylation patterns at the promoter region of tumor suppressor genes (e.g., RASSF1A).</p>Formula:C9H18N2O4Purity:Min. 95%Molecular weight:218.25 g/molAc-Leu-Glu-His-Asp-chloromethylketone
CAS:<p>Ac-Leu-Glu-His-Asp-chloromethylketone is a creatine kinase inhibitor that prevents the conversion of ATP to ADP. It inhibits mitochondrial pathways, leading to apoptotic and proapoptotic effects. Ac-Leu-Glu-His-Asp-chloromethylketone also has a kinetic effect on cells, where it causes necrotic cell death. This compound can cause proteolytic activity, which leads to the activation of caspase 9 and matrix metalloproteinases. Ac-Leu-Glu-His-Asp chloromethylketone has been shown to have antiinflammatory properties in cellular assays, as well as an ability to inhibit the synthesis of cellular proteins.</p>Formula:C24H35ClN6O9Purity:Min. 95%Molecular weight:587.02 g/molMAGE-1 Antigen (161-169) (human) acetate salt
CAS:<p>MAGE-1 is a costimulatory molecule that is expressed on the surface of antigen presenting cells. It has been shown to be a very potent target for monoclonal antibodies. MAGE-1 can be used as an antigen in diagnostic tests, such as ELISA and Western blotting. It can also be used to generate monoclonal antibodies for use as therapeutic agents in cancer therapy and for the treatment of viral infections such as influenza virus. The MAGE-1 antigen has been shown to have high affinity binding with the paratope of Papilloma virus, which may help explain its clinical relevance in these diseases.</p>Formula:C41H57N11O17Purity:Min. 95%Molecular weight:975.96 g/molH-Tyr-betaNA
CAS:<p>H-Tyr-betaNA is a synthetic substrate that has been used to study the binding activities of natural and synthetic opioid compounds. H-Tyr-betaNA binds to δ opioid receptors and inhibits the release of neurotransmitters such as acetylcholine, histamine, and serotonin. It also binds to δ-opioid receptors, which are involved in mediating pain responses. This compound has been shown to be an inhibitor of antinociceptive responses in rats, but it is not yet known whether it can cross the blood brain barrier. The pharmacokinetic properties of H-Tyr-betaNA have not been fully elucidated; however, it has been shown to be stable at neutral ph.</p>Formula:C19H18N2O2Purity:Min. 95%Molecular weight:306.36 g/molNeurokinin A trifluoroacetate salt
CAS:<p>Neurokinin A trifluoroacetate salt H-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2 trifluoroacetate salt is a potent inducer of the basic protein. It has been shown to have cytotoxic effects on pluripotent cells in vitro. Neurokinin A is also a potent inducer of substance P, which is a neurotransmitter that mediates inflammatory lesions and cardiac effects. Neurokinin A has also been shown to have an effect on locomotor activity and polymerase chain reaction (PCR) amplification in vitro.</p>Formula:C50H80N14O14SPurity:Min. 95%Molecular weight:1,133.32 g/mol1-(3-Chloro-4-methoxyphenyl)acetone
CAS:<p>1-(3-Chloro-4-methoxyphenyl)acetone is a white solid with a melting point of 60-61°C. It is a versatile building block that can be used in the synthesis of complex compounds and as a reaction component for the preparation of speciality chemicals. 1-(3-Chloro-4-methoxyphenyl)acetone has been studied extensively as an intermediate for the synthesis of pharmaceuticals, including acetaminophen and amoxicillin. This compound also has uses in research laboratories and as a reagent in organic synthesis.</p>Formula:C10H11ClO2Purity:Min. 95%Molecular weight:198.65 g/molH-Gly-Gly-His-OH
CAS:<p>H-Gly-Gly-His-OH is a molecule that is found in human serum. It is a ligand with coordination properties and has been shown to bind to copper. H-Gly-Gly-His-OH has been studied spectroscopically in the presence of human serum albumin, and it has been observed that the protonation state and interaction of this molecule are dependent on the speciation and concentration of copper.</p>Formula:C10H15N5O4Purity:Min. 95%Molecular weight:269.26 g/molCyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala)
CAS:<p>Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) is a cyclic peptide that has a conformational interaction with fibrinogen. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) binds to the FGA binding site on fibrinogen, preventing the formation of the fibrin clot. Cyclo(-Gly-Arg-Gly-Asp-Ser-Pro-Ala) has been shown to activate platelets, which may be due to its ability to increase levels of cAMP and activate protein kinase A. Cyclo(-Gly-Arg-Gly-Asp-) also has an affinity for monoclonal antibodies, which may be due to its high molecular electrostatic potential or its synthetic nature.</p>Formula:C25H40N10O10Purity:Min. 95%Molecular weight:640.65 g/molN1-Glutathionyl-spermidine disulfide [
CAS:<p>N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescence</p>Formula:C34H66N12O10S2Purity:Min. 95%Molecular weight:867.09 g/molKALA Amphipathic Peptide
CAS:<p>Please enquire for more information about KALA Amphipathic Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C144H248N40O35SPurity:Min. 95%Molecular weight:3,131.82 g/molAc-Ile-Tyr(PO3H2)-Gly-Glu-Phe-NH2 ammonium salt
CAS:<p>Please enquire for more information about Ac-Ile-Tyr(PO3H2)-Gly-Glu-Phe-NH2 ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C33H45N6O12PPurity:Min. 95%Molecular weight:748.72 g/molL-Threonine derivative-1
CAS:<p>L-Threonine derivative-1 is acetylsalicylic acid-L-threonine ester with potential analgesic activity.</p>Formula:C13H15NO6Purity:97.03% - 98.91%Color and Shape:SolidMolecular weight:281.26Z-Tyr-Leu-NH2
CAS:<p>The compound Z-Tyr-Leu-NH2 is a synthetic molecule that inhibits the activity of metalloproteases. It binds to the active site of these enzymes, preventing them from cleaving their substrates. The enzyme's activity is inhibited by binding to uncharged amino acid residues in the active site, which prevents attack by the metal ion and therefore prevents cleavage of substrate proteins. Z-Tyr-Leu-NH2 has been shown to be effective against proteases that are involved in Alzheimer's disease and other neurodegenerative diseases. The optimal pH for this compound is 7.5, with a reaction time of 1 hour at 37 degrees Celsius. The transition temperature for this compound is -10 degrees Celsius, with a phase transition at -4 degrees Celsius.</p>Formula:C23H29N3O5Purity:Min. 95%Molecular weight:427.49 g/molH-D-Ile-OBzl·p-tosylate
CAS:<p>H-D-Ile-OBzl·p-tosylate is a synthetic compound that has been found to have an excitatory effect on the bitter taste receptor. The leaves of plants are mutant and agglutination tests for this compound show that it is a hexapeptide. H-D-Ile-OBzl·p-tosylate can be synthesized from erythritol and p-toluenesulfonyl chloride. The chemical data for this compound indicates that it has a molecular weight of 442.3 Da and the observed spectra indicate that it is a white solid with no charge.</p>Formula:C13H19NO2·C7H8O3SPurity:Min. 95%Molecular weight:393.5 g/molCyclo(-Pro-Gly)3
CAS:<p>Please enquire for more information about Cyclo(-Pro-Gly)3 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C21H30N6O6Purity:Min. 95%Molecular weight:462.5 g/molH-Gly-Arg-Asp-Gly-Ser-OH
CAS:<p>A monoclonal antibody is a type of antibody produced by a single clone of B cells. Monoclonal antibodies are created by injecting mice with a protein, and then harvesting the antibody-producing cells from the mouse's spleen or lymph nodes. These cells are then fused with cancer cells to form hybridoma cells that produce the desired antibodies. Monoclonal antibodies are used in vitro assays to detect certain molecules, such as matrix molecules, growth factors and polysialic acid. They can also be used for in vivo diagnostic purposes, such as detecting urothelial carcinoma in mammals or human lymphocytes on the surface of lymphocytes.</p>Formula:C17H30N8O9Purity:Min. 95%Molecular weight:490.47 g/molH-Lys-Ala-AMC hydrochloride salt
CAS:<p>Please enquire for more information about H-Lys-Ala-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H26N4O4Purity:Min. 95%Molecular weight:374.43 g/molH-Thr-Tyr-Ser-OH
CAS:<p>H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.</p>Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/molPAR-4 (1-6) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about PAR-4 (1-6) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C28H41N7O9Purity:Min. 95%Molecular weight:619.67 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:<p>3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.</p>Purity:Min. 95%Molecular weight:171.22 g/molGRF (human) acetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molBradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt
CAS:<p>Please enquire for more information about Bradykinin-Like Neuropeptide (Aplysia californica) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H98N24O14SPurity:Min. 95%Molecular weight:1,327.56 g/molH-Val-Ala-pNA acetate salt
CAS:<p>Please enquire for more information about H-Val-Ala-pNA acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H20N4O4Purity:Min. 95%Molecular weight:308.33 g/molBoc-Arg-SBzl·HCl
CAS:<p>Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molAc-Ser-Gly-OH
CAS:<p>Ac-Ser-Gly-OH is a tripeptide, meaning it has three amino acids. It is a hydrophobic molecule that contains the sequence of amino acid residues Ac-Ser-Gly. The residue of Ac-Ser-Gly-OH is an acetylated serine and glycolic acid. This tripeptide can be modified through techniques such as incubation or tryptic digestion. The postsynthetic modification technique of biosynthesis is used to create Ac-Ser-Gly-OH from its precursor, polyisoprenoid, which can also be sequenced to determine its nature with the help of techniques such as mass spectrometry.</p>Formula:C7H12N2O5Purity:Min. 95%Molecular weight:204.18 g/molH-Ala-Pro-Tyr-Ala-OH
CAS:<p>Acetylation is the process of reacting an organic compound with acetic acid to produce an ester and water. Acetylation is one of the most common reactions in organic chemistry. Acetylating agents, such as acetic anhydride or acetyl chloride, are often used in chemical synthesis because they react selectively with primary and secondary alcohols to form esters. The acetylation reaction can be used to modify proteins by attaching an acetyl group to the amine group of a lysine residue. This modification prevents the protein from binding to other proteins and can alter its function. Acetylation also has been implicated in several diseases, such as hepatitis and inflammatory bowel disease.</p>Formula:C20H28N4O6Purity:Min. 95%Molecular weight:420.46 g/mol(Lys7)-Phalloidin trifluoroacetate
CAS:<p>Please enquire for more information about (Lys7)-Phalloidin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C35H49N9O9S•(C2HF3O2)xPurity:Min. 95%Molecular weight:771.88 g/molBiotinyl-BNP-32 (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Biotinyl-BNP-32 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C153H258N52O44S5Purity:Min. 95%Molecular weight:3,690.34 g/molL-Lysine methyl ester 2HCl
CAS:<p>L-Lysine methyl ester 2HCl is a lysine derivative that has been synthesized by reacting L-lysine with methanol and hydrochloric acid. This compound's cytotoxicity has been demonstrated in an inhibition study using calf thymus dna. L-Lysine methyl ester 2HCl contains amide, acid, and ester linkages, as well as hydrogen bonds that are typical of natural compounds. It is also biologically active and has a molecular weight of 246.3 g/mol. The chemical structure of this compound consists of a central l-lysine molecule with two methyl groups on the nitrogen atom. The compound also contains a carboxyl group on the end of the chain and an ester group on the second carbon atom from the end of the chain. L-Lysine methyl ester 2HCl can be found in soybeans and bovine fetal tissue. It exhibits morphological properties similar to other</p>Formula:C7H16N2O2·2HClPurity:Min. 95%Color and Shape:PowderMolecular weight:233.14 g/molZ-Ala-Ala-Lys-4MbetaNA formiate salt
CAS:<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C31H39N5O6·CH2O2Purity:Min. 95%Molecular weight:623.7 g/molH-Ile-NHOH acetate salt
CAS:<p>H-Ile-NHOH acetate salt is an inhibitor of l-amino acid metabolism. It is a competitive inhibitor of the enzyme L-amino acid oxidase, which catalyzes the conversion of l-amino acids to alpha-keto acids and ammonia. H-Ile-NHOH acetate salt has been shown to inhibit the growth of wild type C. glutamicum in a molecular modeling study. In addition, this compound has been shown to block messenger RNA (mRNA) synthesis in a mutant strain of C. glutamicum that does not have the frameshifting mutation. H-Ile-NHOH acetate salt is also known to be an inhibitor of fatty acid biosynthesis by blocking the activity of acyl carrier protein synthetase and acyl carrier protein reductase.</p>Formula:C6H14N2O2Purity:Min. 95%Molecular weight:146.19 g/molExtracellular Death Factor trifluoroacetate salt
CAS:<p>Extracellular Death Factor is a molecule that binds to calmodulin, which is a protein found in all animal cells. Extracellular Death Factor can be used to induce apoptotic cell death in any type of cell, including cancer cells. The molecule is composed of three amino acids: H-Asn-Asn-Trp-Asn-Asn-OH. This compound has been shown to inhibit the replication of DNA and RNA in gram negative bacteria and tuberculosis cells. It also has an effect on the structural analysis of the molecule and causes light emission when exposed to ultraviolet light.</p>Formula:C27H36N10O10Purity:Min. 95%Molecular weight:660.64 g/molZ-Trp-Leu-OH
CAS:<p>Please enquire for more information about Z-Trp-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C25H29N3O5Purity:Min. 95%Molecular weight:451.51 g/molH-Trp-Met-OH
CAS:<p>The molecular formula for H-Trp-Met-OH is CHNOS. It is a neutral, solubilized, imino amide residue of L-phenylalanine. The compound has not been identified but it is presumed to be an azide or sulfate ester of tyrosine. This compound was isolated from the membranes of bacteria and peptidases break it down into other amino acids with the exception of lysine. The yield from this reaction is unknown.</p>Formula:C16H21N3O3SPurity:Min. 95%Molecular weight:335.42 g/molZ-Pro-Leu-Gly-NHOH
CAS:<p>Z-Pro-Leu-Gly-NHOH is a proteolytic enzyme that hydrolyzes collagen, an extracellular matrix protein. It is used in the workstation to extract proteins from biological samples such as mesenteric tissue or holothuria. The immobilized enzyme is prepared and stored on the workstation. The sample is then extracted by adding hydroxamic acids in a liquified state and separating the mixture using size exclusion chromatography. The proteolytic activity of Z-Pro-Leu-Gly-NHOH can be measured by its ability to hydrolyze collagen under alkaline conditions.</p>Formula:C21H30N4O6Purity:Min. 95%Molecular weight:434.49 g/molHCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt
CAS:<p>Please enquire for more information about HCV NS4A Protein (22-33) (FDA strain) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C54H99N15O14SPurity:Min. 95%Molecular weight:1,214.52 g/molH-Ala-D-Ala-Ala-OH
CAS:<p>Please enquire for more information about H-Ala-D-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/molBz-Ala-Arg-OH
CAS:<p>Bz-Ala-Arg-OH (BAR) is a peptidase that hydrolyzes peptide bonds in proteins. BAR has been shown to have an intravascular function, which means it is found in the blood and vascular endothelium. BAR has also been shown to be an effective agent for inhibiting the release of hydrogen peroxide (H2O2) induced by dimethylthiourea in isolated rat lungs. BAR was isolated from the rat hypothalamus and shows a high degree of similarity to other peptidases such as aminopeptidase N, carboxypeptidase A, and carboxypeptidase B. These enzymes are involved in the catabolism of hormones such as angiotensin II, adrenocorticotropic hormone, and vasopressin.</p>Formula:C16H23N5O4Purity:Min. 95%Molecular weight:349.39 g/mol

