Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(4,012 products)
- Amino Acid and Amino Acid Related Compounds(3,490 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38366 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-Gly-b-Ala-b-Ala-OH
CAS:Please enquire for more information about H-Gly-b-Ala-b-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C8H15N3O4Purity:Min. 95%Molecular weight:217.22 g/molN1-Glutathionyl-spermidine disulfide [
CAS:N1-Glutathionyl-spermidine disulfide (N1-GS) is a molecule that has been shown to have clinical use in the treatment of chronic hepatitis C infection. The N1-GS molecule is composed of a glutathione (GSH) scaffold with two sulfhydryl groups and an amino acid side chain. N1-GS has a hydrophobic nature, which allows it to penetrate the cellular membrane and enter cells. It is also able to form hydrogen bonds and act as a catalyst for reactions. Fluorescence analysis revealed that this molecule is selective for disulfides over thiols, amines, or alcohols. Disulfides are very important in biological systems since they can be found in enzymes, proteins, and cellular membranes. The insolubility of the N1-GS molecule makes it difficult to analyze its structure using traditional methods such as gas chromatography or nuclear magnetic resonance spectroscopy. However, fluorescenceFormula:C34H66N12O10S2Purity:Min. 95%Molecular weight:867.09 g/mol2'-Methoxy-alpha-naphthoflavone
CAS:2'-Methoxy-alpha-naphthoflavone is a fine chemical that can be synthesized from naphthalene, benzaldehyde, and methoxyacetic acid. It is a versatile building block for research chemicals and has been shown to have high quality. 2'-Methoxy-alpha-naphthoflavone has been used as a reaction component in the synthesis of complex compounds with interesting biological activities.Formula:C20H14O3Purity:Min. 95%Molecular weight:302.32 g/molH-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt
CAS:The compound H-Tyr-Tyr-Tyr-Tyr-Tyr-Tyr-OH trifluoroacetate salt is a synthetic antigen for use in the production of immunoadsorbent conjugates. It is a postulated fluorescence molecule that interacts with specific antibodies to form an antigen. This antigen can be used as a probe for detecting antibodies in biological fluids and tissues by fluorescence microscopy and has been shown to have no antigenicity in skin reactions.Formula:C54H56N6O13Purity:Min. 95%Molecular weight:997.06 g/mol6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt
CAS:Please enquire for more information about 6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimethylaminocoumarin-4-yl)-acetyl)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C78H111N21O16Purity:Min. 95%Molecular weight:1,598.85 g/molBradykinin (1-3) sulfate salt
CAS:Bradykinin (BK) is a peptide hormone that is released by the endothelium of blood vessels in response to injury. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is a synthetic version of the BK sequence with sulfate groups on the amino acids and an additional acid substitution. This molecule has been shown to be fully functional as a copolymer in thrombin activation, oligopeptide, and angiotensin production. Bradykinin (1-3) sulfate salt H-Arg-Pro-Pro-OH is stable at pH 3 and above, which makes it suitable for use in nutrient media, such as media for growing bacteria or yeast. It also has been shown to have platelet aggregation properties similar to those found in natural BK.Formula:C16H28N6O4Purity:Min. 95%Molecular weight:368.43 g/mol(2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate
CAS:Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H20N2O4Purity:Min. 95%Molecular weight:244.29 g/molH-Val-Met-OH
CAS:H-Val-Met-OH is a synthetic compound that was created to have a structure similar to the natural amino acid histidine. The synthesis of H-Val-Met-OH was achieved by reacting 2,5-diaminopentane with formaldehyde in the presence of cellulose acetate as a reaction medium. This process produced a white solid material that was then purified using chromatography. The purity and yield were confirmed by high performance liquid chromatography (HPLC) analysis and nuclear magnetic resonance (NMR). In vitro studies showed that H-Val-Met-OH promotes brain derived neurotrophic factor (BDNF) production in healthy Chinese adults. Clinical data also suggest that H-Val-Met-OH has beneficial effects on cognitive function in patients with mild cognitive impairment or Alzheimer's disease. Additionally, this compound has been shown to promote BDNF production in cultured mouse hippocampal neurons and enhance spatial memory retention in CD1 mice.
Formula:C10H20N2O3SPurity:Min. 95%Molecular weight:248.34 g/molHexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt
Please enquire for more information about Hexanoyl-(Ala19,Lys27·28)-VIP (free acid) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C153H250N44O43SPurity:Min. 95%Molecular weight:3,425.96 g/molBig Endothelin-1 (human)
CAS:Please enquire for more information about Big Endothelin-1 (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C189H282N48O56S5Purity:Min. 95%Molecular weight:4,282.88 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/molRetrocyclin-1 trifluoroacetate salt
CAS:Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/mol(D-Trp6)-LHRH (2-10) trifluoroacetate salt
CAS:Please enquire for more information about (D-Trp6)-LHRH (2-10) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H77N17O11Purity:Min. 95%Molecular weight:1,200.35 g/molSuc-Val-Pro-Phe-SBzl
CAS:Suc-Val-Pro-Phe-SBzl is a synthetic subtilisin that has been modified to have an enhanced binding affinity for the enzyme's substrate. The enzyme's specificity and reactivity has been improved by adding a chloromethyl ketone group to the amino acid sequence. Suc-Val-Pro-Phe-SBzl is a serine protease inhibitor and has been shown to inhibit the activity of subtilisins, including subtilisin BPN' and Bacillus amyloliquefaciens subtilisin. It also inhibits peptidases and proteinases, which may be due to its ability to bind to the active site of these enzymes.Formula:C30H37N3O6SPurity:Min. 95%Molecular weight:567.7 g/molMca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt
CAS:Please enquire for more information about Mca-(Asn670,Leu671)-Amyloid beta/A4 Protein Precursor770 (667-675)-Lys(Dnp) ammonium acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C68H88N14O27Purity:Min. 95%Molecular weight:1,533.5 g/mol(Nle 35)-Amyloid b-Protein (1-42) ammonium salt
CAS:Please enquire for more information about (Nle 35)-Amyloid b-Protein (1-42) ammonium salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C204H313N55O60Purity:Min. 95%Molecular weight:4,496 g/molH-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2
CAS:Please enquire for more information about H-Lys-Lys-Glu-Asp-Val-Val-Abu-Cys-Ser-Abu-Ser-Tyr-Lys-Lys-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H119N19O21SPurity:Min. 95%Molecular weight:1,582.86 g/molZ-Arg-Arg-pNA·2 HCl
CAS:Please enquire for more information about Z-Arg-Arg-pNA·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H36N10O6·2HClPurity:Min. 95%Molecular weight:657.55 g/molH-Ala-D-Ala-Ala-OH
CAS:Please enquire for more information about H-Ala-D-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C9H17N3O4Purity:Min. 95%Molecular weight:231.25 g/molH-His-His-OH trifluoroacetate salt
CAS:H-His-His-OH trifluoroacetate salt is a compound that has been extensively studied for its potential use in antimicrobial peptides. It is a small molecule that inhibits the activity of enzymes by binding to a specific region on the enzyme's surface, thereby preventing the progression of an essential chemical reaction. H-His-His-OH trifluoroacetate salt has been shown to inhibit protein synthesis in bacteria and yeast cells, as well as in model systems. The inhibition of protein synthesis may be due to hydrogen bonding between the hydroxyl group on His and the amino groups on His. H-His-His-OH trifluoroacetate salt also has an inhibitory effect on enzymes catalysis and can enhance their activity when used with another substrate.Formula:C12H16N6O3Purity:Min. 95%Molecular weight:292.29 g/mol
![6-(7-Nitro-benzo[2,1,3]oxadiazol-4-ylamino)-hexanoyl-Arg-Pro-Lys-Pro-Leu-Ala-Nva-Trp-Lys((7-dimeth…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFN110943.webp&w=3840&q=75)
