Amino Acids (AA)

<p>Please enquire for more information about H-beta-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Kisspeptin-54 (27-54) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (3,4-Dehydro-Pro3)-Tuftsin including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-alpha-Z-L-lysine methyl ester hydrochloride is a preparation that is used as a methyl ester. It is an ester of lysine and methyl chloride. This product has a molecular weight of 170.16 g/mol and the chemical formula CH3CONHCH2CH(NH)CO2CH3. The structural data has not been confirmed by X-ray crystallography, but it can be assumed to be in the form of a zwitterion. N-alpha-Z-L-lysine methyl ester hydrochloride can be used for the synthesis of peptides, which are building blocks for proteins and enzymes. N-alpha-Z-L-lysine methyl ester hydrochloride is also used in the production of certain kinds of drugs and organic acids such as acetylsalicylic acid (aspirin).</p>

<p>Please enquire for more information about Boc-Ala-D-Glu-NH2 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (H-Cys-Val-OH)2 (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Hippuryl-Phe-Arg-OH is a potent and selective inhibitor of angiotensin-converting enzyme (ACE) with a long duration of action. It has been shown to be a potentiator of captopril and enalaprilat in the biochemical validation for ACE inhibition. Hippuryl-Phe-Arg-OH has significant inhibitory activity against phosphatases such as carboxypeptidase A, phospholipase A2, and aminopeptidase N.</p>

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about Ac-Asp-Met-Gln-Asp-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Ac-Ala-Ala-OMe is a molecule that has conformational and interaction properties. It is an amide residue found in proteins. The amino acid sequence of Ac-Ala-Ala-OMe contains an elongating residue with a specific profile, which can be used as a molecule to study acylases. Acetamide, the precursor of Ac-Ala-Ala-OMe, is an acid methyl ester that has been shown to interact with chloride ions. When acetamide interacts with chloride ions, it undergoes a shift in its structure and produces the product Ac-Ala-Ala-OMe. This process may be due to solvent effects (i.e., the effect of water).</p>

<p>Please enquire for more information about PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Val-Lys-Lys-Arg-4MbNA is a synthetic peptide that is used for staining of fixed cells. It binds to lysosomal membrane proteins and stains with a red color when reacted with a chromogen. This product is used as an intermediate in the production of monoclonal antibodies. Z-Val-Lys-Lys-Arg-4MbNA is also used to detect lysosomes in unfixed cells by histochemically staining the reaction product with a solution of buffers and biochemical, following incubation at 37°C for 24 hours. This product has been shown to bind to cellular morphology, fibroblasts, and stained tissue sections.</p>

<p>Please enquire for more information about H-D-Arg(Pbf)-allyl ester hydrochloride including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-4-phosphono-Phe(Bzl)-OH is an efficient solid phase peptide synthesizer. It has been used in the synthesis of a variety of peptides, including those with short sequences and bulky side chains. Fmoc-4-phosphono-Phe(Bzl)-OH is an efficient synthesis reagent for the solid phase peptide synthesis of small or medium size peptides, which are difficult to synthesize with other methods.</p>

<p>Please enquire for more information about Suc-Ala-Ala-Val-AMC including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Leu-Ser(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-D-Met-Met-OH is a synthetic compound, which is an optical isomer of DL-methionine. It has been shown to have the same biochemical and dietary concentrations as DL-methionine. H-D-Met-Met-OH has also been shown to have a linear response in bioassays, assays and other biochemical pathways. The thermodynamic properties of this compound are also similar to those of DL-methionine, although it is not as stable. This compound can be used as a substitute for DL-methionine because it has an identical chemical structure and can be converted into L -methionine by the enzyme methioninase.</p>

<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Gln22)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Tyr-Ala-OH is a peptidomimetic that has shown promising anti-inflammatory and anticancer properties. It has been found to inhibit the proliferation of human cancer cells and to suppress the growth of human tumor xenografts in mice. It also has shown an ability to cross the blood brain barrier, which may be due to its high lipophilicity. H-Ala-Tyr-Ala-OH inhibits the production of inflammatory cytokines, such as TNFα, IL1β, IL6, and IL8, by inhibiting NFκB activation in immune cells. This inhibition leads to decreased inflammation and fibrosis in various tissues. H-Ala-Tyr-Ala-OH is also active against bacteria and viruses, which may be due to its low molecular weight.</p>

<p>Please enquire for more information about H-Val-Pro-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about VIP Receptor-Binding Inhibitor L-8-K trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Intermediate in the synthesis of idelalisib (CAL 101)</p>

<p>ACTH is a hormone that is produced by the anterior lobe of the pituitary gland. It stimulates the release of cortisol from the adrenal cortex. ACTH (7-38) has been shown to have cytosolic Ca2+ channel-blocking and antimicrobial activities, as well as an effect on defensin production in human neutrophils. ACTH (7-38) also has been shown to inhibit cytokine production in rat astrocytes, and to stimulate prostaglandin synthesis in mouse fibroblasts. This peptide also has been shown to have physiological effects on bowel disease and inflammatory bowel disease.</p>

<p>Please enquire for more information about Angiotensin I (1-9) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Fmoc-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Pro-Leu-Gly-OEt is a cyclic tripeptide that can be synthesized using ammonium sulfate as a catalyst. The reaction time required is between 4 and 12 hours, with the optimum at 8 hours. Resonances have been observed in the 1H NMR spectrum of Z-Pro-Leu-Gly-OEt. The most prominent resonance appears at δ 9.5 ppm. The cyclization of Z-Pro-Leu-Gly-OEt is catalysed by ammonium sulfate, which also produces a reaction yield of 100%. The effect of pH on the rate constant for the reaction has been studied and it was found that there was no significant difference in reactivity when the pH was varied between 7 and 11. Sulfoxide formation has also been monitored during synthesis, but concentrations are low enough to not affect the yield or reactivity of the product. The conformational structure of Z-Pro-Le</p>

<p>Please enquire for more information about Z-Gly-Gly-Phe-bNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Mca-Arg-Pro-Lys-Pro-Val-Glu-Nva-Trp-Arg-Lys(Dnp)-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Phe-OMe is a model amide that has been used to study the serine protease catalysed hydrolysis of peptides. This compound is a water molecule analogue that is immobilized on an ion exchange resin, which can be used as a support for experiments in catalysis and thermodynamics. Z-Ala-Phe-OMe has shown to be more efficient than other substrates and can be used to study kinetic data and thermodynamic properties.</p>

<p>Please enquire for more information about Neuropeptide Y (free acid) (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-His-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about 5-Bromo-2-hydroxy-3-methyl pyrazine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about RecA-Like Protein (193-212) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin I/II (1-5) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Boc-His(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>(R)-2-Hydroxy-4-phenylbutanoic acid is an ester compound that is produced by the conversion of (S)-malic acid to its enantiomer. This reaction is catalyzed by a phosphoric acid esterase. The kinetic, immobilization, and transfer mechanisms have been characterized. The solubilized form of the enzyme was found to be more active than the crystalline form. Enzyme inhibitors such as hydrogen chloride and hydrochloric acid were also investigated in order to determine their effect on the reaction rate and product distribution. A structural formula for (R)-2-Hydroxy-4-phenylbutanoic acid was determined using nuclear magnetic resonance spectroscopy and mass spectrometry, revealing a dinucleotide phosphate as a possible intermediate in the synthesis pathway.</p>

<p>Ac-Ala-Ala-Ala-Ala-OMe is a peptidase that hydrolyzes the ester bonds of the hydrophobic amino acid residues, such as alanine, valine, leucine, and isoleucine. This enzyme deacylates and releases these amino acids from the side chain of their corresponding fatty acyl groups. Ac-Ala-Ala-Ala-Ala-OMe also acts on N terminal and C terminal residues. The presence of a scissile bond in the peptide substrate is required for this enzyme to function. Acetylation reactions are concurrent with acylation reactions, which produce an acetylated peptide product.</p>

<p>Z-Trp-Ala-OH is an imidazolide that is used as a potassium supplement. It has the potential to be used in the treatment of epilepsy, but more research is needed to determine its safety and efficacy.</p>

<p>Please enquire for more information about H-Ala-D-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>N-Methyl-N-phenylcarbamoyl chloride is a fluorinated compound that has been shown to be resistant to treatments with chlorides. It is used for kinetic studies of amines and other functional assays. Deuterium isotope effects have been observed in chloride ion binding experiments, which indicate that the molecule has a greater affinity for the chloride ion than does its non-deuterated counterpart.</p>

<p>H-Gly-DL-Thr-OH is an organic compound that is a component of natural phenolic compounds. This compound is generated by the pyrolysis of biomass, and it has been shown to have selective properties for GC-MS analysis. H-Gly-DL-Thr-OH can be used as a sustainable chemical component in the production of biofuels and other chemicals. The optimal conditions for this synthesis are potassium hydroxide, temperature, pressure, and irradiation time. The separation parameters for H-Gly-DL-Thr-OH are based on its GC retention time and mass spectra.</p>

<p>2,4-Dichloro-5-methoxyaniline (2,4-DMA) is a trifluoroacetic acid derivative that inhibits the growth of cancer cells by interfering with cellular processes such as DNA replication and protein synthesis. It has been shown to have anticancer activity in vitro and in vivo. In addition, 2,4-DMA can inhibit the growth of cancer cells by preventing epidermal growth factor from binding to its receptor on the cell surface. A recent study showed that 2,4-DMA has anti-angiogenic properties and can prevent tumor growth by inhibiting bcr-abl kinase activity. 2,4-DMA also has an acidic property which may be due to its conversion of trifluoroacetic acid into hydrogen fluoride (HF) and hydrogen chloride (HCl).<br>2,4-Dichloro-5-methoxyaniline was approved for use in Japan</p>

<p>TRH is a hormone that regulates the metabolic rate and stimulates the pancreas to release insulin. It also has been shown to be involved in regulating locomotor activity and is used in clinical trials for its potential therapeutic effects on Alzheimer’s disease. TRH binds to receptors on gland cells where it activates adenylate cyclase and increases intracellular levels of cAMP, which leads to an increase in cytosolic calcium concentration. TRH also binds to receptors on nerve cells and causes these cells to release neurotransmitters such as dopamine and serotonin. TRH is synthesized by the thyroid gland, pituitary gland, hypothalamus, or other tissues in response to stress or illness. TRH can be administered orally or injected intravenously; it is not active when taken orally because it is broken down by digestive enzymes before reaching the systemic circulation.</p>

<p>Please enquire for more information about Autocamtide-2-Related Inhibitory Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Phe-Ser-OH is a molecule that is present in the bacterial strain. It can be used in diagnosis, where it can be detected by messenger RNA profiling and kinetic analysis of uptake. In vitro synthesis of H-Phe-Ser-OH was performed using caco-2 cells and metabolic profiles were obtained from this experiment. Hydroxyl groups are found on the molecule, which are important for diagnostic purposes. This molecule has been shown to form hydrogen bonds with other molecules, which may also be useful for diagnostic tests.</p>

<p>4-Chloro-6-methoxyquinoline is an inhibitor of bacterial DNA gyrase. It has antibacterial activity against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus, Enterococcus faecalis, and Pseudomonas aeruginosa. 4-Chloro-6-methoxyquinoline is a synthetic compound that was reinvestigated for its antibacterial activity. It has been shown to be effective in the treatment of Staphylococcal infections. The mechanism of action may involve inhibition of topoisomerase II or interference with the synthesis of DNA by binding to the enzyme bacterial DNA gyrase. Quinidine and cinchonidine are quinine derivatives that have been found to inhibit bacterial DNA gyrase. These compounds are found in the bark of Cinchona species, which includes Cinchona ledgeriana, Cinchona officinalis, and Cinchona succirub</p>

<p>Please enquire for more information about Z-Ala-Ala-Lys-4MbetaNA formiate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>