Amino Acids (AA)
Amino acids (AAs) are the fundamental building blocks of proteins, playing a crucial role in various biological processes. These organic compounds are essential for protein synthesis, metabolic pathways, and cell signaling. In this category, you will find a comprehensive range of amino acids, including essential, non-essential, and modified forms, which are vital for research in biochemistry, molecular biology, and nutritional sciences. At CymitQuimica, we provide high-quality amino acids to support your research and development needs, ensuring accuracy and reliability in your experimental outcomes.
Subcategories of "Amino Acids (AA)"
- Amino Acid Derivatives(4,014 products)
- Amino Acid and Amino Acid Related Compounds(3,490 products)
- Amino Acids with Oxygen or Sulphur(168 products)
- Boc- Amino Acids(351 products)
- Fmoc Amino Acids(1,710 products)
Found 38368 products of "Amino Acids (AA)"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Human CMV pp65 (495-503) trifluoroacetate salt
CAS:Please enquire for more information about Human CMV pp65 (495-503) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C42H74N10O12SPurity:Min. 95%Molecular weight:943.16 g/molSauvagine trifluoroacetate salt
CAS:Sauvagine is a trifluoroacetate salt of Pyr-Gly-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Ser-Leu-Glu-Leu-Leu-Arg. It has been used as a model system to study the effects of trifluoroacetic acid on brain functions. Sauvagine has also been shown to have inhibitory effects on cyclase enzymes, which are involved in the synthesis of steroids and other hormones. This compound has also been found to have an effect on locomotor activity and receptor activity.Formula:C202H346N56O63SPurity:Min. 95%Molecular weight:4,599.31 g/molBoc-Arg-SBzl·HCl
CAS:Please enquire for more information about Boc-Arg-SBzl·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C18H28N4O3S·HClPurity:Min. 95%Molecular weight:416.97 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS:Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C32H38N4O7SPurity:Min. 95%Molecular weight:622.73 g/molRetrocyclin-1 trifluoroacetate salt
CAS:Retrocyclin-1 trifluoroacetate salt is a synthetic antimicrobial peptide, which is derived from humanized sequences based on the theta-defensin family, originally found in certain primates. Retrocyclin-1 is particularly notable for its circular structure which contributes to its stability and biological activity. The peptide is produced through a process of solid-phase peptide synthesis, designed to mimic the native cyclic conformation of natural theta-defensins.Formula:C74H128N30O18S6Purity:Min. 95%Molecular weight:1,918.4 g/molH-Ser-Glu-OH
CAS:H-Ser-Glu-OH is a carbohydrate. It has been shown to be involved in the diagnosis of pancreatic cancer by binding to the peptide transporter and inhibiting its function. H-Ser-Glu-OH binds to a number of chemotactic proteins that are involved in the inflammatory response. This interaction may lead to degranulation and lysosome release, which could cause an increase in cancer cells. The carbohydrate ligand on H-Ser-Glu-OH is acidic and has functional groups that allow it to interact with other molecules in a way that is not possible for monosaccharides.Formula:C8H14N2O6Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:234.21 g/molGRF (human) acetate salt
CAS:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H358N72O66SPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:5,039.65 g/mol3-Amino-4-methyl-thiophen-2-carboxylic acid methyl ester
CAS:3-Amino-4-methylthiophen-2-carboxylic acid methyl ester (3AMTC) is a novel compound that has been shown to have antihypertensive activity, as well as other pharmacological actions. 3AMTC is an allosteric modulator of α7 nicotinic acetylcholine receptors, which are found in the central and peripheral nervous system. The efficacy of 3AMTC was evaluated using magnetic resonance spectroscopy to measure the effects on mouse tumor cells. This compound showed no carcinogenic potential, which may be due to its inability to cross the blood brain barrier.Purity:Min. 95%Molecular weight:171.22 g/molKininogen-Based Thrombin Inhibitor
CAS:Please enquire for more information about Kininogen-Based Thrombin Inhibitor including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C29H46N8O7SPurity:Min. 95%Molecular weight:650.79 g/molCatestatin (human) trifluoroacetate
CAS:Please enquire for more information about Catestatin (human) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C104H164N32O27SPurity:Min. 95%Molecular weight:2,326.68 g/molH-Cys-psi(CH2NH)Val-psi(CH2NH)Phe-Met-OH trifluoroacetate salt
CAS:FTI-277 is a peptidomimetic compound that inhibits HIV-1 protease. FTI-277 is an orally active, potent, and selective inhibitor of HIV-1 protease. The drug has been shown to be effective in the treatment of HIV infection in various clinical trials. FTI-277 inhibited HIV replication in activated cells and disrupted virion production by binding to the target enzyme. FTI-277 also has potential for use as a diagnostic tool for detecting the presence of HIV in body fluids.Formula:C22H38N4O3S2Purity:Min. 95%Molecular weight:470.69 g/molSapecin
CAS:Sapecin is an antimicrobial peptide, which is derived from the hemolymph of the silk moth (Bombyx mori) with potent bactericidal action. The source of Sapecin is the immune system of the silk moth, where it acts as a natural defense mechanism against microbial infections. Its mode of action involves disrupting bacterial cell membranes, leading to cell lysis and death. The peptide achieves this by inserting itself into the lipid bilayer, creating pores that compromise the structural integrity of the membrane.Formula:C164H266N58O52S6Purity:Min. 95%Molecular weight:4,074.62 g/molFmoc-Nle-Nle-OH
CAS:Please enquire for more information about Fmoc-Nle-Nle-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C27H34N2O5Purity:Min. 95%Molecular weight:466.57 g/molH-Thr-Tyr-Ser-OH
CAS:H-Thr-Tyr-Ser-OH is a fluorescent peptide with conjugates that has been shown to be sequestered in atherosclerotic lesions. The fluorescence of this peptide is increased when bound to lipofuscin, which accumulates in atherosclerotic lesions. Immunohistochemical staining has revealed that H-Thr-Tyr-Ser-OH is a marker for the identification of atheromas and can be used to identify areas of lipid accumulation. H-Thr-Tyr-Ser-OH binds to peroxidases and enzyme linked immunosorbent assay (ELISA) antibodies, making it useful as an indicator for the presence of these enzymes. This peptide also stains positively for markers such as CD11b, CD68, and lysozyme.Formula:C16H23N3O7Purity:Min. 95%Molecular weight:369.37 g/mol1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole
CAS:Please enquire for more information about 1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H17BN2O2Purity:Min. 95%Color and Shape:PowderMolecular weight:208.07 g/molTyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt
CAS:Please enquire for more information about Tyr-Lys-Gly-(Cyclo(Glu26-Lys29),Pro34)-Neuropeptide Y (25-36) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C91H145N27O20Purity:Min. 95%Molecular weight:1,937.29 g/molL-Lysine diisocyanate
CAS:L-Lysine diisocyanate is an organic compound that is a reactive site for the production of calcium stearate and ethylene diamine. It has been shown to be a reactive site in vitro, but not in vivo. L-Lysine diisocyanate reacts with water vapor to produce hydrogen cyanide, which is toxic to cells. The presence of l-lysine can inhibit the formation of hydrogen cyanide, but it also inhibits uptake into cells and tissue cultures.Formula:C8H10N2O4Purity:Min. 95 Area-%Molecular weight:198.18 g/molN-2-Ethoxyethyl-Val-Ala-anilide
CAS:Please enquire for more information about N-2-Ethoxyethyl-Val-Ala-anilide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C18H29N3O3Purity:Min. 95%Molecular weight:335.44 g/molS-(1,2-Dicarboxyethyl)glutathione
CAS:S-(1,2-Dicarboxyethyl)glutathione is a glutathione analogue that has been shown to prevent acetaminophen-induced hepatotoxicity in mice. It inhibits the reaction between acetaminophen and hepatic microsomal cytochrome P450 enzymes, which prevents the formation of toxic metabolites. S-(1,2-Dicarboxyethyl)glutathione also inhibits the production of serotonin by inhibiting the enzyme tryptophan hydroxylase. This drug has an anticoagulant effect by preventing the conversion of prothrombin to thrombin. S-(1,2-Dicarboxyethyl)glutathione also affects growth factors and collagen synthesis by affecting both epidermal growth factor (EGF) and fibroblast growth factor (FGF). The optimum pH for this drug is at 7.0.Formula:C14H21N3O10SPurity:Min. 95%Molecular weight:423.4 g/molZ-Leu-Tyr-chloromethylketone
CAS:Z-Leu-Tyr-chloromethylketone is a peptide that binds to the reticulum and prevents the release of calcium ions. It is a chloromethyl ketone, which inhibits the L-type calcium channels in cells. Z-Leu-Tyr-chloromethylketone has been shown to block the influx of calcium ions into cytosolic compartments. This process leads to inhibition of protein synthesis and cell death by apoptosis.
Formula:C24H29ClN2O5Purity:Min. 95%Molecular weight:460.95 g/mol
![1-Methyl-4-(4,4,5,5-tetramethyl-[1,3,2]dioxaborolan-2-yl)-1h-imidazole](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FFM166321.webp&w=3840&q=75)
