Peptides
Subcategories of "Peptides"
Found 29641 products of "Peptides"
H-QPFPQPELPYP-OH
Peptide H-QPFPQPELPYP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WEAALAEALAEALAEHLAEALAEALEALAA-OH
CAS:H-WEAALAEALAEALAEHLAEALAEALEALAA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QYFTVFDR-OH
Peptide H-QYFTVFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CCFHCQVC-OH
Peptide H-CCFHCQVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLGEEEALEDDSESR-OH
Peptide H-VLLGEEEALEDDSESR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RWKKNFIAVSAANRFKKIS-OH
Peptide H-RWKKNFIAVSAANRFKKIS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EAGDEFELR-OH
Peptide H-EAGDEFELR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ATQQFQQL-OH
Peptide H-ATQQFQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:963.1 g/molH-NPPIPVGDIY-OH
Peptide H-NPPIPVGDIY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AYLLPAPPAPGNASESEEDR-OH
Peptide H-AYLLPAPPAPGNASESEEDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KRQQELLRL-OH
Peptide H-KRQQELLRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ARRL-NH2
Peptide H-ARRL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DFTPAAQAAFQK-OH
Peptide H-DFTPAAQAAFQK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALLEDPVGT-OH
Peptide H-ALLEDPVGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPQQHTQVL-OH
Peptide H-IPQQHTQVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IIATDIQTK-OH
Peptide H-IIATDIQTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR-OH
Peptide H-NSQVWLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLMAPVGSV-OH
Peptide H-RLMAPVGSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VGDDHLLLLQGEQLR-OH
Peptide H-VGDDHLLLLQGEQLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RAIEAQQML-OH
Peptide H-RAIEAQQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESSAAKLKRKYWWKNLK-OH
Peptide H-FESSAAKLKRKYWWKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPEEKS-OH
Peptide H-VHLTPEEKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVCGERGFFY-OH
Peptide H-LVCGERGFFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NITIHITDTNN-OH
Peptide H-NITIHITDTNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE-OH
Peptide H-VHLTPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C31H50N8O10Molecular weight:694.78 g/molH-CGRGDSPK-OH
Peptide H-CGRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RYSIFFDYM-OH
Peptide H-RYSIFFDYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPIFIRRL-OH
Peptide H-RPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIVSPFIPLL-OH
Peptide H-SIVSPFIPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAELEHGSSAYSPPDAFK-OH
Peptide H-VAELEHGSSAYSPPDAFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HPDYSVVLLLR-OH
Peptide H-HPDYSVVLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPPPPPPPPPPPPPPPPP-OH
H-PPPPPPPPPPPPPPPPPPPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-ETSNFGFSLLR-OH
Peptide H-ETSNFGFSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AHYDLR-OH
Peptide H-AHYDLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-HAVDIGGGKC-OH acetate salt 98%
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-VLDFAPPGA-OH
Peptide H-VLDFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH
H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-QLLQHYREV-OH
Peptide H-QLLQHYREV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLGPGVNYSGCQITWAK-OH
Peptide H-LLGPGVNYSGCQITWAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PKEK-OH
Peptide H-PKEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C22H40N6O7Molecular weight:500.6 g/molH-EFRHDSGY-NH2
Peptide H-EFRHDSGY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GKDPNYRDEAIRSIE-OH
Peptide H-GKDPNYRDEAIRSIE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH
Peptide H-DGSVVVNKVSELPAGHGLNVNTLSYGDLAAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDALHMQALPPR-OH
Peptide H-YDALHMQALPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKTDHGAEIVYKSPVVSGDTSPR-OH
Peptide H-AKTDHGAEIVYKSPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLQLDEETGEFL-OH
Peptide H-QLQLDEETGEFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLELTSDNDR-OH
Peptide H-VLELTSDNDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-INITRFQTL-OH
Peptide H-INITRFQTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QEPSQGTTTFAVTSILR-OH
Peptide H-QEPSQGTTTFAVTSILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STKKLSECEKRIGDELDSNM-OH
H-STKKLSECEKRIGDELDSNM-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-EIYKRWIILGLNKIVRMY-OH
Peptide H-EIYKRWIILGLNKIVRMY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPSYVYHQF-OH
Peptide H-SPSYVYHQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ETTIQGLDGLSER-OH
Peptide H-ETTIQGLDGLSER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DVDVPDGRGDSLAYG-OH
Peptide H-DVDVPDGRGDSLAYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPIGAGICASY-OH
Peptide H-IPIGAGICASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HKKKHPDASVNFSE-OH
Peptide H-HKKKHPDASVNFSE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALYLVCGER-OH
Peptide H-EALYLVCGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GTITSGWTF-OH
Peptide H-GTITSGWTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PPGNYIGERPY-OH
Peptide H-PPGNYIGERPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRLSYSRRRF-OH
Peptide H-RRLSYSRRRF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-APRGPHGGAASGL-OH
Peptide H-APRGPHGGAASGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITFPGLHEL-OH
Peptide H-ITFPGLHEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QRPIFIITEYMANGCLLNYLR-OH
Peptide H-QRPIFIITEYMANGCLLNYLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTNFPICIFCCKCCNNSQCGICCKT-OH
H-DTNFPICIFCCKCCNNSQCGICCKT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-ARYAYYLQF-OH
Peptide H-ARYAYYLQF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDSIICVK-OH
Peptide H-LDSIICVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLDALQAIK-OH
Peptide H-VLDALQAIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAVP-OH
Peptide H-FAVP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYTSGEACL-OH
Peptide H-TYTSGEACL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2
H-FITC-FLPLLILGSLLMTPPVIQAIHDAQR-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-WFDF-OH
Peptide H-WFDF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FYVQALLR-OH
Peptide H-FYVQALLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TENLYFQGDISR-OH
Peptide H-TENLYFQGDISR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIAFSR-OH
Peptide H-SIAFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALNTLVKQ-OH
H-ALNTLVKQ-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KTTKQSFDL-OH
Peptide H-KTTKQSFDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WMESEFRVY-OH
Peptide H-WMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DKKQRFHNIRGRWTG-OH
Peptide H-DKKQRFHNIRGRWTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WQWR-OH
Peptide H-WQWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTAGFLIFL-OH
Peptide H-LTAGFLIFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRIFDLIEL-OH
Peptide H-RRIFDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VWLSVIWM-OH
Peptide H-VWLSVIWM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QKLVFFAE-NH2
Peptide H-QKLVFFAE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2
H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-GPGRAFVTI-OH
Peptide H-GPGRAFVTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQAGASQ-OH
Peptide H-LQAGASQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESEERPPTPY-OH
Peptide H-ESEERPPTPY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VIYEQANAHGQ-OH
Peptide H-VIYEQANAHGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRGDKGPDC-NH2
CAS:Peptide H-CRGDKGPDC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C35H57N13O14S2Molecular weight:948.04 g/molH-GDLLAEIETDKAT-OH
Peptide H-GDLLAEIETDKAT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLYNCCYHV-OH
H-LLYNCCYHV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-CQLLPQHQVPAY-OH
Peptide H-CQLLPQHQVPAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLYPNDNFFEGK-OH
Peptide H-VLYPNDNFFEGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VLYDEFVTI-OH
Peptide H-VLYDEFVTI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LDFVRFMGV-OH
Peptide H-LDFVRFMGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FLWGPRAHA-OH
Peptide H-FLWGPRAHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKKTFKEVANAVKISASLMG-OH
Peptide H-RKKTFKEVANAVKISASLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QSSGGDPEIVMHSFN-OH
Peptide H-QSSGGDPEIVMHSFN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STDTAYMELSSLR-OH
Peptide H-STDTAYMELSSLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Abl Cytosolic Substrate
CAS:Custom research peptide; min purity 98%. For different specs please use the Peptide Quote Tool
Formula:C64H101N15O16Molecular weight:1,336.61 g/mol
