Peptides
Subcategories of "Peptides"
Found 29633 products of "Peptides"
H-QPAPENAYQAY-OH
Peptide H-QPAPENAYQAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FAFRDLCIVY-OH
Peptide H-FAFRDLCIVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RALGPGATL-OH
Peptide H-RALGPGATL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LRRATLG-OH
Peptide H-LRRATLG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FPPPKVIQ-OH
Peptide H-FPPPKVIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KKMRNEENEDSEGELTNVDC-OH
Peptide H-KKMRNEENEDSEGELTNVDC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGDPPLPTL-OH
Peptide H-GGDPPLPTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VVIA-OH
Peptide H-VVIA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C30H46N6O9Molecular weight:634.73 g/molH-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH
H-CGGGQVTTESNLVEFDEESTKGIVTGAVSDHTTVEDTK-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-DISEMFLQIYK-OH
Peptide H-DISEMFLQIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ITKPALLVLNEHTAK-OH
Peptide H-ITKPALLVLNEHTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH
Peptide H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVVVMIPSYALHR-OH
Peptide H-GVVVMIPSYALHR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YEVHHQKL-NH2
Peptide H-YEVHHQKL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDSPASSKP-OH
Peptide H-RGDSPASSKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C40H68N14O16Molecular weight:1,001.1 g/molH-VLHPLEGAVVIIFK-OH
Peptide H-VLHPLEGAVVIIFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRSFIEDLLF-OH
Peptide H-KRSFIEDLLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIGPGQAFYATGDII-OH
Peptide H-RIGPGQAFYATGDII-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YCQVVCTYHPR-OH
Peptide H-YCQVVCTYHPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDIDIER-OH
H-IDIDIER-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-SRLSKVAPVIKARMMEYGTT-OH
Peptide H-SRLSKVAPVIKARMMEYGTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WWKR-NH2
Peptide H-WWKR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CYSLYGTTL-OH
Peptide H-CYSLYGTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SIINFEPL-OH
Peptide H-SIINFEPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VPTIVMVDAYKRYK-OH
Peptide H-VPTIVMVDAYKRYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RIRTLTEPSVDC-OH
Peptide H-RIRTLTEPSVDC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WYQNMIR-OH
Peptide H-WYQNMIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SALVNEYNVDASR-OH
Peptide H-SALVNEYNVDASR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVSPFIPLL-OH
Peptide H-IVSPFIPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MTEQQWNFAGIEAAA-OH
Peptide H-MTEQQWNFAGIEAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPQKRPSCIGC-OH
Peptide H-RPQKRPSCIGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTHFPICIFCCGCCHRSKCGMCCKT-OH
Peptide H-DTHFPICIFCCGCCHRSKCGMCCKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLSLPETGELDSATLK-OH
Peptide H-QLSLPETGELDSATLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPPNWHIPSIQDA-OH
Peptide H-IPPNWHIPSIQDA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH
Peptide H-EAEDLQVGQVELGGGPGAGSLQPLALEGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGAGHVPEYFVGIGTPISFYG-OH
Peptide H-GGAGHVPEYFVGIGTPISFYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ISIDVNNNDIK-OH
Peptide H-ISIDVNNNDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VFIEDVSR-OH
Peptide H-VFIEDVSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WSPGGQML-OH
Peptide H-WSPGGQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFLTVKKQM-OH
Peptide H-AFLTVKKQM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LSVPTSEWQR-OH
Peptide H-LSVPTSEWQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GCPPDDIENPR-OH
Peptide H-GCPPDDIENPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PFSEQEQPV-OH
Peptide H-PFSEQEQPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLKRRRCF-OH
Peptide H-SLKRRRCF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LPRRNRWSKIWKKVVTVFS-NH2
Peptide H-LPRRNRWSKIWKKVVTVFS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SELEIKRY-OH
Peptide H-SELEIKRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-INTVNSNTLPVLR-OH
Peptide H-INTVNSNTLPVLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILLARLFLY-OH
Peptide H-ILLARLFLY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SYGQPQSGSYSQQPS-OH
Peptide H-SYGQPQSGSYSQQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLLLLK-OH
Peptide H-KLLLLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPPPPPP-OH
Peptide H-PPPPPPPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EVGDWRK-OH
Peptide H-EVGDWRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EALYLVCG-OH
Peptide H-EALYLVCG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLLLWITAA-OH
Peptide H-VLLLWITAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
H-AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C190H288N54O57Molecular weight:4,240.7 g/molH-GFLSKSLVF-OH
Peptide H-GFLSKSLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LQVGQVELGGGPGAGSLQ-OH
Peptide H-LQVGQVELGGGPGAGSLQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SNLELLR-OH
Peptide H-SNLELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGIGKIGDFIKKAIAKYKN-OH
H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-KRPPIFIRRL-OH
Peptide H-KRPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EEPSLLKKLLLAPA-OH
Peptide H-EEPSLLKKLLLAPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFLINETAR-OH
Peptide H-NFLINETAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPKVPLRTM-OH
Peptide H-RPKVPLRTM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IDEALER-OH
Peptide H-IDEALER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HQKLVFFA-NH2
Peptide H-HQKLVFFA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IPNAGQMQPVK-OH
Peptide H-IPNAGQMQPVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SCSSCPLSK-OH
Peptide H-SCSSCPLSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPAPITR-OH
Peptide H-DLPAPITR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESIKKKVL-OH
Peptide H-SESIKKKVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2
H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NAVEVLKR-OH
Peptide H-NAVEVLKR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KLWAQCVQL-OH
Peptide H-KLWAQCVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLFNKVTLA-OH
Peptide H-LLFNKVTLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TITLEVESSDTIDNVK-OH
Peptide H-TITLEVESSDTIDNVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVAASQAALGL-OH
Peptide H-LVAASQAALGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EIVLTQSPATLSLSP-OH
H-EIVLTQSPATLSLSP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AVLLTANPASTAK-OH
Peptide H-AVLLTANPASTAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RISTFKNWPK-OH
Peptide H-RISTFKNWPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RADEEQQQALSSQMGF-OH
H-RADEEQQQALSSQMGF-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AALEDTLAETEAR-OH
Peptide H-AALEDTLAETEAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGSC-OH
Peptide H-GGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLDTASTTL-OH
Peptide H-NLDTASTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SESGQFHAF-OH
Peptide H-SESGQFHAF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FYLYDSETK-OH
Peptide H-FYLYDSETK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SFRNGVGTGMKKTSFQRAKS-OH
Peptide H-SFRNGVGTGMKKTSFQRAKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Adipophilin
Peptide Adipophilin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C35H63N9O14Molecular weight:833.94 g/molH-QIRPIFSNR-OH
Peptide H-QIRPIFSNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLQPLALEG-OH
Peptide H-SLQPLALEG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIAFSR-OH
Peptide H-SIAFSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALNTLVKQ-OH
H-ALNTLVKQ-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-CKNIQWKERSKQSA-OH
Peptide H-CKNIQWKERSKQSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WMESEFRVY-OH
Peptide H-WMESEFRVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DKKQRFHNIRGRWTG-OH
Peptide H-DKKQRFHNIRGRWTG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-WQWR-OH
Peptide H-WQWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTAGFLIFL-OH
Peptide H-LTAGFLIFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RRIFDLIEL-OH
Peptide H-RRIFDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLIYSASYR-OH
Peptide H-LLIYSASYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QKLVFFAE-NH2
Peptide H-QKLVFFAE-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2
H-SMCC-SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
