Peptides
Subcategories of "Peptides"
Found 29631 products of "Peptides"
H-STHVDIRTLEDLLMG-OH
Peptide H-STHVDIRTLEDLLMG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ESTLHLVLRLRGG-OH
Peptide H-ESTLHLVLRLRGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPYEGSLLLKLLRAPVEEV-OH
Peptide H-LPYEGSLLLKLLRAPVEEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NFLINETAR-OH
Peptide H-NFLINETAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KRPPIFIRRL-OH
Peptide H-KRPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AFDAAVSGKSVS-OH
Peptide H-AFDAAVSGKSVS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AGIGKIGDFIKKAIAKYKN-OH
H-AGIGKIGDFIKKAIAKYKN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-SNLELLR-OH
Peptide H-SNLELLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DSLFIPIR-OH
Peptide H-DSLFIPIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EVVADSVWVDVK-OH
Peptide H-EVVADSVWVDVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IGEEYISDLDQLRK-OH
Peptide H-IGEEYISDLDQLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALYLVCGE-OH
Peptide H-ALYLVCGE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HPVGEADYF-OH
Peptide H-HPVGEADYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLSAWILTA-OH
Peptide H-LLSAWILTA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAA-OH
Peptide H-AAAAAAAAAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FKDPNAPK-OH
Peptide H-FKDPNAPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALWKTLLKKVLKA-NH2
Peptide H-ALWKTLLKKVLKA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH
H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHN-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-NGLHLPSYSPYPR-OH
Peptide H-NGLHLPSYSPYPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLFGAIAGFI-OH
Peptide H-GLFGAIAGFI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIAQDFK-OH
Peptide H-EIAQDFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLSKGCFGLKLDRIGSMSGLGC-OH
H-GLSKGCFGLKLDRIGSMSGLGC-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LKYWWNLLQYWSQEL-OH
H-LKYWWNLLQYWSQEL-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-SPHQVFNL-OH
Peptide H-SPHQVFNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Molecular weight:941.1 g/molH-APQPAPENAY-OH
Peptide H-APQPAPENAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVFGIELMEV-OH
Peptide H-LVFGIELMEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LITTQQWLIK-OH
Peptide H-LITTQQWLIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPVLANVGQIR-OH
Peptide H-LPVLANVGQIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASSTLYLVF-OH
Peptide H-ASSTLYLVF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YKRWIILGLNKIVRMYS-OH
Peptide H-YKRWIILGLNKIVRMYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AITEVECFL-OH
Peptide H-AITEVECFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLYHFLQIPTHEEHLFYVLS-OH
Peptide H-QLYHFLQIPTHEEHLFYVLS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NLVPIVATV-OH
Peptide H-NLVPIVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SENDRLRLL-OH
Peptide H-SENDRLRLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FASFEAQGALANIAVDK-OH
Peptide H-FASFEAQGALANIAVDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLLQHYREV-OH
Peptide H-QLLQHYREV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTAYHVSTAPTGSWF-OH
Peptide H-LTAYHVSTAPTGSWF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RGSGR-OH
Peptide H-RGSGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH
H-FIHHIIGGLFSAGKAIHRLIRRRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolAc-HAVDIGGGKC-OH acetate salt 98%
Custom research peptide; min purity 98%. For different specs please use the Peptide Quote ToolH-WFSAGLASNSSWLR-OH
Peptide H-WFSAGLASNSSWLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ERMF-OH
Peptide H-ERMF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLR-OH
Peptide H-KLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ETSNFGFSLLR-OH
Peptide H-ETSNFGFSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PPPPPPPPPPPPPPPPPPPP-OH
H-PPPPPPPPPPPPPPPPPPPP-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-AIV-OH
Peptide H-AIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HPDYSVVLLLR-OH
Peptide H-HPDYSVVLLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAELEHGSSAYSPPDAFK-OH
Peptide H-VAELEHGSSAYSPPDAFK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSNLR-OH
Peptide H-SSNLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQHLVNELTHDIITK-OH
Peptide H-LQHLVNELTHDIITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SIVSPFIPLL-OH
Peptide H-SIVSPFIPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPPIFIRRL-OH
Peptide H-RPPIFIRRL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RYSIFFDYM-OH
Peptide H-RYSIFFDYM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGGGGC-OH
Peptide H-GGGGGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGRGDSPK-OH
Peptide H-CGRGDSPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPE-OH
Peptide H-VHLTPE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C31H50N8O10Molecular weight:694.78 g/molH-NITIHITDTNN-OH
Peptide H-NITIHITDTNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EGDCAPEEK-OH
Peptide H-EGDCAPEEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VHLTPEEKS-OH
Peptide H-VHLTPEEKS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NPDDPDTVDVIMHMLDR-OH
Peptide H-NPDDPDTVDVIMHMLDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FESSAAKLKRKYWWKNLK-OH
Peptide H-FESSAAKLKRKYWWKNLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAYGRQVYL-OH
Peptide H-VAYGRQVYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RLMAPVGSV-OH
Peptide H-RLMAPVGSV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RMMRTKMRM-OH
Peptide H-RMMRTKMRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NSQVWLGR-OH
Peptide H-NSQVWLGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RKIYDLIEL-OH
Peptide H-RKIYDLIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GPFPIIV-OH
Peptide H-GPFPIIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSVFVPPR-OH
Peptide H-VSVFVPPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GSKKPVPIIYCNRRTGKCQRM-OH
Peptide H-GSKKPVPIIYCNRRTGKCQRM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EMPSEEGYQDYEPEA-OH
Peptide H-EMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYFPHFDVSHGSAQVK-OH
Peptide H-TYFPHFDVSHGSAQVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CASDAKAYDTEVHNV-OH
H-CASDAKAYDTEVHNV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-FLLKLTPLL-OH
Peptide H-FLLKLTPLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RPR-OH
Peptide H-RPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CFFQNCPKG-NH2
CAS:H-CFFQNCPKG-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C46H65N13O11S2Molecular weight:1,040.23 g/molH-IVGGWECEK-OH
Peptide H-IVGGWECEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IQKEIDRLNEVAKNLNESLI-OH
Peptide H-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KMLKEMGEV-OH
Peptide H-KMLKEMGEV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGRKSSKMQA-OH
Peptide H-SGRKSSKMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDNNLTRIVGGQE-OH
Peptide H-RGDNNLTRIVGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RERQR-OH
Peptide H-RERQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EQEQMISCKFNMTGL-OH
Peptide H-EQEQMISCKFNMTGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KHFGKDSNFPFGT-OH
H-KHFGKDSNFPFGT-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolH-VNVDEVGGEALGR-OH
Peptide H-VNVDEVGGEALGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LHGGSPWPPCQYR-OH
Peptide H-LHGGSPWPPCQYR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLVDLEPGTMDSVR-OH
Peptide H-AVLVDLEPGTMDSVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YFDSFGDLSSASAIMGNAK-OH
Peptide H-YFDSFGDLSSASAIMGNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLPLTFGGGTK-OH
Peptide H-DLPLTFGGGTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIDTAA-OH
Peptide H-DIDTAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GHQAAMQML-OH
Peptide H-GHQAAMQML-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQQCPF-OH
Peptide H-LQQCPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLWEWASVR-OH
Peptide H-YLWEWASVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C192H295N61O60SMolecular weight:4,449.9 g/molH-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2
H-CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C145H240N44O48S2Molecular weight:3,431.9 g/molH-NVTGFFQSLK-OH
Peptide H-NVTGFFQSLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ILYENNVIT-OH
Peptide H-ILYENNVIT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GQAEPDRAHYNIVTF-OH
Peptide H-GQAEPDRAHYNIVTF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-WYQSIR-OH
Peptide H-WYQSIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPETER-OH
Peptide H-TPETER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YLYRLFRKSNLKPFE-OH
Peptide H-YLYRLFRKSNLKPFE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
