Peptides
Subcategories of "Peptides"
Found 29681 products of "Peptides"
Myristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C74H128N16O18Molecular weight:1,529.95 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SMolecular weight:4,271.67 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Molecular weight:1,171.33 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SMolecular weight:2,668.90 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formula:C42H61N11O10Molecular weight:880.02 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purity:Min. 95%Color and Shape:PowderMolecular weight:2,695.98 g/molCalcineurin Autoinhibitory Fragment
Catalogue peptide; min. 95% purity
Formula:C124H205N39O39S2Molecular weight:2,930.38 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formula:C194H296N54O57SMolecular weight:4,328.91 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Molecular weight:1,664.90 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molBiotin-Neurokinin B
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Molecular weight:1,326.53 g/molInfluenza A NP (366-374)
Catalogue peptide; min. 95% purity
Formula:C36H59N11O17S2Molecular weight:982.06 g/molα-Neo-Endorphin (1-7)
Catalogue peptide; min. 95% purity
Formula:C40H61N11O9Molecular weight:840.00 g/molFibronectin Type III Connecting Segment (1-25)
Catalogue peptide; min. 95% purity
Formula:C123H195N31O39Molecular weight:2,732.04 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formula:C35H41N5O12Molecular weight:723.7 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Molecular weight:1,543.77 g/mol[Arg0] Met-Enkephalin
Catalogue peptide; min. 95% purity
Formula:C33H47N9O8SMolecular weight:729.86 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C56H85N17O13Molecular weight:1,204.41 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formula:C82H122N22O25SMolecular weight:1,848.08 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Molecular weight:902.02 g/molγ-Bag Cell Peptide
Catalogue peptide; min. 95% purity
Formula:C31H51N11O8Molecular weight:705.82 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formula:C46H75N9O11S2Molecular weight:994.28 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:402.65 g/molRef: 3D-EB110885
Discontinued productH-Ala-Abu-OH
CAS:Please enquire for more information about H-Ala-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H14N2O3Purity:Min. 90%Color and Shape:PowderMolecular weight:174.2 g/molRef: 3D-FA107958
Discontinued productDynorphin A (2-12), porcine
Catalogue peptide; min. 95% purity
Formula:C60H105N21O12Molecular weight:1,312.64 g/molDynorphin A (3-8), porcine
Catalogue peptide; min. 95% purity
Formula:C35H60N12O7Molecular weight:760.94 g/molbeta-Amyloid (17-40)
Catalogue peptide; min. 95% purity
Formula:C110H178N26O31SMolecular weight:2,392.86 g/molFluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ala-Glu(OMe)-Val-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C41H43FN4O14Purity:Min. 95%Molecular weight:834.8 g/molRef: 3D-FF111115
Discontinued productPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SMolecular weight:1,464.75 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formula:C59H91N11O15Molecular weight:1,194.45 g/molBoc-D-His(Boc)-OH benzene solvate
CAS:Please enquire for more information about Boc-D-His(Boc)-OH benzene solvate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C16H25N3O6Purity:Min. 95%Color and Shape:SolidMolecular weight:355.39 g/molRef: 3D-FB111250
Discontinued productTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Molecular weight:1,657.95 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Molecular weight:1,260.47 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Molecular weight:2,325.82 g/molrec IFN-gamma (human)
CAS:Controlled ProductPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FR108523
Discontinued productBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Molecular weight:3,552.17 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Molecular weight:850.00 g/molBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SMolecular weight:3,849.30 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SMolecular weight:1,664.92 g/molCorticotropin trifluoroacetate
Please enquire for more information about Corticotropin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-BC183139
Discontinued productInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Molecular weight:1,622.77 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SMolecular weight:1,269.31 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Molecular weight:1,009.19 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SMolecular weight:3,199.65 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formula:C42H66N10O15Molecular weight:951.05 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Molecular weight:1,078.25 g/molDok-5 (263-275)
Catalogue peptide; min. 95% purity
Formula:C75H114N24O19Molecular weight:1,655.89 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Molecular weight:1,862.77 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Molecular weight:4,190.77 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Molecular weight:424.50 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Molecular weight:2,311.60 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Molecular weight:5,155.22 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Molecular weight:3,555.01 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Molecular weight:2,167.52 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Molecular weight:1,440.81 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Molecular weight:1,383.68 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molSialokinin - 2
Catalogue peptide; min. 95% purity
Formula:C51H76N12O16SMolecular weight:1,145.31 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Molecular weight:1,715.91 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Molecular weight:1,667.90 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Molecular weight:2,342.56 g/molBoc-D-Glu-OEt·DCHA
CAS:Controlled ProductPlease enquire for more information about Boc-D-Glu-OEt·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C12H21NO6·C12H23NPurity:Min. 95%Molecular weight:456.62 g/molRef: 3D-FB111281
Discontinued productZ-Ala-Arg-Arg-AMC hydrochloride salt
CAS:Z-Ala-Arg-Arg-AMC hydrochloride salt is a synthetic amino acid that inhibits aminopeptidase activity. It is used to study the enzyme's role in the degradation of muscle proteins, and as a pharmaceutical drug for treating inflammatory bowel disease. The target enzyme is inhibited by binding to its active site, thereby preventing the breakdown of peptides. Z-Ala-Arg-Arg-AMC hydrochloride salt can be used as an inhibitor in the laboratory because it prevents denaturation of protein samples during analysis using electrophoresis or chromatography. This product also has been shown to have inhibitory effects on ileal aminopeptidases and prostate aminopeptidases, which may be due to its ability to bind to these enzymes and block their active sites.
Formula:C33H44N10O7•(HCl)xPurity:Min. 95%Molecular weight:692.77 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purity:Min. 95%Molecular weight:552.6 g/molAngiotensin II Substrate
Catalogue peptide; min. 95% purity
Formula:C50H72N13O15PMolecular weight:1,126.20 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurity:Min. 95%Molecular weight:1,754.92 g/molH-Asp-NH2
CAS:H-Asp-NH2 is an isomeric mixture of l-phenylalanine and its methyl ester. It is used as a feed additive in animals to improve growth and feed conversion efficiency. The deamination of H-Asp-NH2 produces hydrogen peroxide, which has been shown to be lethal to enterobacteriaceae. This compound may also act as a microbial growth inhibitor by preventing the formation of peptides during synthesis.
Formula:C4H8N2O3Purity:Min. 95%Molecular weight:132.12 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurity:Min. 95%Molecular weight:910.46 g/molRef: 3D-FP107899
Discontinued product(Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt
CAS:Please enquire for more information about (Deamino-Phe19,D-Ala24,D-Pro26-psi(CH2NH)Phe27)-GRP (19-27) (human, porcine, canine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C57H72N14O8Purity:Min. 95%Molecular weight:1,081.27 g/molRef: 3D-FD108769
Discontinued productbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formula:C170H253N47O52Molecular weight:3,787.20 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Molecular weight:966.18 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Arg0] Met-Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00699.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
