Peptides
Subcategories of "Peptides"
Found 29844 products of "Peptides"
NES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Molecular weight:1,564.86 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Molecular weight:523.55 g/mol[Tyr27]-pTH (27-48) (human)
Catalogue peptide; min. 95% purity
Formula:C104H159N29O31Molecular weight:2,311.60 g/molbeta-Defensin-3, human
Catalogue peptide; min. 95% purity
Formula:C216H371N75O59S6Molecular weight:5,155.22 g/molBiotin-ACTH (1-39), human
Catalogue peptide; min. 95% purity
Formula:C217H322N58O60SMolecular weight:4,767.47 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Molecular weight:937.08 g/mol[Ala4]-MBP (1-11)
Catalogue peptide; min. 95% purity
Formula:C49H81N21O17Molecular weight:1,236.32 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formula:C59H97N17O19Molecular weight:1,348.53 g/mol[Thr46]-Osteocalcin (45-49) (human)
Catalogue peptide; min. 95% purity
Formula:C25H37N5O7Molecular weight:519.6 g/molNps-Val-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molRef: 3D-FN107891
Discontinued productbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/molHIV-gp41-Antigenic Peptide 5
Catalogue peptide; min. 95% purity
Formula:C184H282N56O53S2Molecular weight:4,190.77 g/molDesmopressin
CAS:Controlled ProductDesmopressin is a synthetic analog of the natural hormone arginine vasopressin. It has been shown to be effective in the treatment of primary nocturnal enuresis, and a number of studies have reported that desmopressin is an effective therapy for idiopathic nocturnal enuresis. Desmopressin also has effects on water permeability, hemolysis, and protein synthesis. It increases the concentration of camp levels in urine and plasma while also inhibiting erythrocyte aggregation. Desmopressin has been shown to be more effective than placebo in women with primary nocturnal enuresis.Formula:C46H64N14O12S2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,069.22 g/molTNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Molecular weight:1,667.90 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Molecular weight:5,971.67 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Molecular weight:2,573.99 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formula:C35H41N5O12Molecular weight:723.7 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111724
Discontinued product[Ile12, Val15] MUC5AC Analog 3
Catalogue peptide; min. 95% purity
Formula:C67H112N16O25Molecular weight:1,541.73 g/molCalcitonin N-Terminal Flanking Peptide, human
Catalogue peptide; min. 95% purity
Formula:C264H426N74O97SMolecular weight:6,220.84 g/molFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Molecular weight:359.43 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molRef: 3D-FS108741
Discontinued productP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Molecular weight:1,657.95 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
Catalogue peptide; min. 95% purity
Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molbeta-Casomorphin (1-3) amide
Catalogue peptide; min. 95% purity
Formula:C23H28N4O4Molecular weight:424.50 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formula:C133H204N34O37SMolecular weight:2,903.38 g/molDok-6 (263-275)
Catalogue peptide; min. 95% purity
Formula:C76H113N25O18Molecular weight:1,664.90 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Molecular weight:1,345.62 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Molecular weight:1,260.47 g/molDok-4 (263-275)
Catalogue peptide; min. 95% purity
Formula:C70H101N21O18Molecular weight:1,524.72 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Molecular weight:2,342.56 g/molParallel topology beta-Amyloid modified peptide
Catalogue peptide; min. 95% purity
Formula:C151H211N37O39SMolecular weight:3,199.65 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Thr46]-Osteocalcin (45-49) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00401.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ile12, Val15] MUC5AC Analog 3](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00456.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
