
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30433 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-VAVVR-OH
<p>Peptide H-VAVVR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-STQAAINQINGK-OH
Peptide H-STQAAINQINGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTYRYI-OH
<p>Peptide H-DTYRYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MHVAQPAVVLASSR-OH
<p>Peptide H-MHVAQPAVVLASSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SQIMYNYPA-OH
<p>Peptide H-SQIMYNYPA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEKAHDGGR-OH
<p>Peptide H-CEKAHDGGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIIAYTMSL-OH
<p>Peptide H-SIIAYTMSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTSPRHLSNVSSTGSI-OH
<p>Peptide H-DTSPRHLSNVSSTGSI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRPPLGNW-OH
<p>Peptide H-NTRPPLGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAHTEDINACTLTTSPR-OH
<p>Peptide H-AAHTEDINACTLTTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEIQLMHNLGK-OH
<p>Peptide H-SVSEIQLMHNLGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DREQAPNLVY-OH
<p>Peptide H-DREQAPNLVY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGACGVGK-OH
<p>Peptide H-VVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AMKRHGLDNYRGYSL-OH
<p>Peptide H-AMKRHGLDNYRGYSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RSDSGQQARY-OH
<p>Peptide H-RSDSGQQARY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQDVHNFVALGAPLAPR-OH
<p>Peptide H-LQDVHNFVALGAPLAPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SPVVSGDTSPR-OH
<p>Peptide H-SPVVSGDTSPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELINNELSHFLEEIK-OH
<p>Peptide H-ELINNELSHFLEEIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVEEVSLRK-OH
<p>Peptide H-AVEEVSLRK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLADEFIIPGLK-OH
<p>Peptide H-VLADEFIIPGLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LEVFYNGAWGTVGK-OH
<p>Peptide H-LEVFYNGAWGTVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QMESQPLPGER-OH
<p>Peptide H-QMESQPLPGER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLPTGAEA-OH
<p>Peptide H-FLLPTGAEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLTELEK-OH
<p>Peptide H-MLTELEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EGEWTEGKLSLRGSC-OH
<p>Peptide H-EGEWTEGKLSLRGSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WWW-OH
<p>Peptide H-WWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTGGANIDPTFFLSR-OH
<p>Peptide H-GTGGANIDPTFFLSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPFEKSTVM-OH
<p>Peptide H-LPFEKSTVM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LVVRYRRNV-OH
<p>Peptide H-LVVRYRRNV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HTLNQIDEVK-OH
<p>Peptide H-HTLNQIDEVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSIHIGPGRAFYATG-OH
<p>Peptide H-KSIHIGPGRAFYATG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLEQELETITIPDVYGAK-OH
<p>Peptide H-FLEQELETITIPDVYGAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-MLLSKINSL-OH
<p>Peptide H-MLLSKINSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVQL-OH
<p>Peptide H-PVQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LTYRHKVVK-OH
<p>Peptide H-LTYRHKVVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YTTGEIIGDIRQAHC-OH
<p>Peptide H-YTTGEIIGDIRQAHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SRVTWYDFLMEDTKSR-OH
<p>Peptide H-SRVTWYDFLMEDTKSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPGPGVRY-OH
<p>Peptide H-TPGPGVRY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLFNTIAVL-OH
<p>Peptide H-SLFNTIAVL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YGSLPQKSQRSQDENPV-OH
<p>Peptide H-YGSLPQKSQRSQDENPV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRFFKTLRAEQATQE-OH
<p>Peptide H-DRFFKTLRAEQATQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFTSSTSYNR-OH
<p>Peptide H-QFTSSTSYNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH
<p>Peptide H-YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VMAPRTLL-OH
<p>Peptide H-VMAPRTLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DTLVNRIEL-OH
<p>Peptide H-DTLVNRIEL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VQSLQDEVAFLR-OH
<p>Peptide H-VQSLQDEVAFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQTQQKQAPTWPCK-OH
<p>Peptide H-HQTQQKQAPTWPCK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVGRLVTVNPFVSVA-OH
<p>Peptide H-PVGRLVTVNPFVSVA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNSCSNRRVYKKMPSIESDV-OH
<p>Peptide H-LNSCSNRRVYKKMPSIESDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPGVRYPLTFGWCY-OH
<p>Peptide H-GPGVRYPLTFGWCY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GPSSVEDIK-OH
<p>Peptide H-GPSSVEDIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIDEVSSLLR-OH
<p>Peptide H-DIDEVSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NMTTELRDKKQKVHA-OH
<p>Peptide H-NMTTELRDKKQKVHA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HEIPVLPNR-OH
<p>Peptide H-HEIPVLPNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLYKLADLI-OH
<p>Peptide H-LLYKLADLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NYNYLYRLF-OH
<p>Peptide H-NYNYLYRLF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPPSSLLR-OH
<p>Peptide H-DPPSSLLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSNNNPTTIMRPPVAQN-OH
<p>Peptide H-LSNNNPTTIMRPPVAQN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APVLFFDR-OH
<p>Peptide H-APVLFFDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TTKEKAQIL-OH
<p>Peptide H-TTKEKAQIL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSEPVYIQPISTRSL-OH
<p>Peptide H-NSEPVYIQPISTRSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLSDGEWQLVLNVWGK-OH
<p>Peptide H-GLSDGEWQLVLNVWGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WIIRNWETV-OH
<p>Peptide H-WIIRNWETV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LRAIEAQQHM-OH
<p>Peptide H-LRAIEAQQHM-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PLKAEIAQRLEDV-OH
<p>Peptide H-PLKAEIAQRLEDV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRLTARGLL-OH
<p>Peptide H-RRLTARGLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATGIPDR-OH
<p>Peptide H-ATGIPDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSFTRGVYY-OH
<p>Peptide H-NSFTRGVYY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSLEGSR-OH
<p>Peptide H-FSLEGSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EAYEMPSEEGYQDYEPEA-OH
<p>Peptide H-EAYEMPSEEGYQDYEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VIMPCSWWV-OH
<p>Peptide H-VIMPCSWWV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SNGNFIAPEYAYKIVK-OH
<p>Peptide H-SNGNFIAPEYAYKIVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSLNLQKDEPNGRASDTAGQ-OH
<p>Peptide H-TSLNLQKDEPNGRASDTAGQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALNSVAYERSAMQNYE-OH
<p>Peptide H-ALNSVAYERSAMQNYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FEWTPGYWQPYALPL-OH
<p>Peptide H-FEWTPGYWQPYALPL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AYPTPLR-OH
<p>Peptide H-AYPTPLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEATFGVDESNAK-OH
<p>Peptide H-VEATFGVDESNAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DWSSWVYRDPQT-OH
<p>Peptide H-DWSSWVYRDPQT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFLVWVNEEDHLR-OH
<p>Peptide H-SFLVWVNEEDHLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SLAFL-OH
<p>Peptide H-SLAFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SFERFEIFPK-OH
<p>Peptide H-SFERFEIFPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-PVVAESPKKP-OH
<p>Peptide H-PVVAESPKKP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHMEPSFGLILHDGG-OH
<p>Peptide H-SHMEPSFGLILHDGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NTRTSINIGPGQVFY-OH
<p>Peptide H-NTRTSINIGPGQVFY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVGADGVGK-OH
<p>Peptide H-VVGADGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELNEALELK-OH
<p>Peptide H-ELNEALELK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YRDGNPYAV-OH
<p>Peptide H-YRDGNPYAV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESLSSYWESAK-OH
<p>Peptide H-ESLSSYWESAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RRRRRRRRRRRRRRRRRR-OH
<p>Peptide H-RRRRRRRRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CEFH-OH
<p>Peptide H-CEFH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LFGGFNSSDTVTSPQR-OH
<p>Peptide H-LFGGFNSSDTVTSPQR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KHLDTKENTHFSQPN-OH
<p>Peptide H-KHLDTKENTHFSQPN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VYIHP-OH
<p>Peptide H-VYIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAPDARETA-OH
<p>Peptide H-AAPDARETA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VLGDSGELDILR-OH
<p>Peptide H-VLGDSGELDILR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLSKQYMDL-OH
<p>Peptide H-FLSKQYMDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LIFAGKQLEDGR-OH
<p>Peptide H-LIFAGKQLEDGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSESGELHGLTTEEEFVEGIYKVEIDTK-OH
<p>Peptide H-TSESGELHGLTTEEEFVEGIYKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RIK-OH
<p>Peptide H-RIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVSEINPTTQMK-OH
Peptide H-SVSEINPTTQMK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
