Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30476 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
HBVpol502, HBV polymerase (502-510)
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H82N14O12Molecular weight:1,107.33 g/molAc-Choline Receptor α1(129-145)
<p>Catalogue peptide; min. 95% purity</p>Formula:C90H136N22O28S2Molecular weight:2,038.34 g/mol2B-(S)
<p>Catalogue peptide; min. 95% purity</p>Formula:C81H138N28O29SMolecular weight:2,000.24 g/molH-Leu-Arg-OH acetate salt
CAS:<p>H-Leu-Arg-OH acetate salt is a cyclase inhibitor that is used to treat cancer. It has been shown to inhibit soluble guanylate cyclase, which is an enzyme that converts guanosine triphosphate (GTP) into the second messenger molecule, cyclic guanosine monophosphate (cGMP). Inhibition of this enzyme results in a decrease in the production of cGMP and blood pressure. H-Leu-Arg-OH acetate salt also inhibits delta opioid receptors, which are found on the surface of cells in the brain. This drug binds competitively with delta opioid receptors and blocks the effect of endogenous or exogenous ligands such as enkephalins.</p>Formula:C12H25N5O3Purity:Min. 95%Color and Shape:PowderMolecular weight:287.36 g/molActivity-Dependent Neurotrophic Factor-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H103N17O17Molecular weight:1,310.57 g/molβ-Lipotropin (61-64)
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H26N4O6Molecular weight:442.48 g/molExperimental Autoimmune Encephalomyelitis Complementary Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H100N14O12Molecular weight:1,197.54 g/mol[Pro18, Asp21] β-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H43N5O8Molecular weight:637.74 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H61N114O8S2Molecular weight:912.15 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H68N16O11Molecular weight:937.08 g/molHepatitis B Virus Receptor Binding Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H185N35O42Molecular weight:3,030.17 g/molGIP, mouse, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C226H343N61O66SMolecular weight:5,002.69 g/molβ-Amyloid/A4 Protein Precusor (APP) (319-335)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H151N31O26S2Molecular weight:2,099.48 g/molFmoc-Thr(tBu)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Thr(tBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Non-Ab Component of Alzheimer's Disease Amyloid
<p>Catalogue peptide; min. 95% purity</p>Formula:C141H235N39O49Molecular weight:3,260.68 g/mol[Pro34]-Neuropeptide Y, human, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C189H285N55O57SMolecular weight:4,271.67 g/molBDC 2.5(A)
<p>Catalogue peptide; min. 95% purity</p>Formula:C60H99N19O14SMolecular weight:1,342.64 g/molAc-Neurotrophin Receptor (368-381) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H124N22O19Molecular weight:1,565.89 g/molβ-Endorphin (1-5), (16-31), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H173N27O29SMolecular weight:2,393.86 g/molHistone H3 (116-136), N15-39
<p>Catalogue peptide; min. 95% purity</p>Formula:C112H197N39O30Molecular weight:2,570 g/molAcyl Carrier Protein (65-74) (acid)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H74N12O16Molecular weight:1,063.18 g/mol(Ile76)-TNF-a (70-80) (human)
CAS:<p>Please enquire for more information about (Ile76)-TNF-a (70-80) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C55H91N15O16Purity:Min. 95%Molecular weight:1,218.4 g/molSMCY (950-960) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H85N15O18Molecular weight:1,172.31 g/molSomatostatin
CAS:<p>Somatostatin is a polypeptide hormone that is produced by the body to inhibit the release of other hormones in the body. It has also been used to treat diseases such as carcinoid syndrome, intestinal disorders, and diabetes mellitus type I. Somatostatin binds to somatostatin receptors on cells, which leads to inhibition of cell growth and secretion of hormones. Somatostatin has been shown to block basic protein synthesis and energy metabolism in rat liver cells. Its receptor activity is mediated by binding with signal peptide sequences and response elements.</p>Formula:C76H104N18O19S2Purity:Min. 95%Color and Shape:PowderMolecular weight:1,637.88 g/molPTH (human) TFA Salt
CAS:<p>Parathyroid hormone receptor agonist</p>Formula:C408H674N126O126S2Purity:Min. 95%Color and Shape:White PowderMolecular weight:9,424.62 g/molSomatostatin Tumor Inhibiting Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H70N11O10S2Molecular weight:1,097.4 g/molpp60(v-SRC) Autophosphorylation Site, Protein Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H109N23O23Molecular weight:1,592.74 g/molAllatostatin VII
<p>Catalogue peptide; min. 95% purity</p>Formula:C46H69N13O13SMolecular weight:1,044.2 g/mol[Pyr11]-Amyloid β-Protein (11-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C143H226N38O39SMolecular weight:3,133.71 g/molAc-ACTH (1-14), 10-1-12A
<p>Catalogue peptide; min. 95% purity</p>Formula:C79H111N21O21SMolecular weight:1,722.96 g/molOrn8, Urotensin II, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H85N13O18S2Molecular weight:1,376.60 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H64N12O19Molecular weight:1,005.01 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H103N21O13Molecular weight:1,362.66 g/molβ-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C216H371N75O59S6Molecular weight:5,155.22 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H54N8O10Molecular weight:782.90 g/molβ-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H209N41O46Molecular weight:3,262.53 g/molβ-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H126N24O21S2Molecular weight:1,896.22 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C219H365N73O66SMolecular weight:5,108.86 g/mol[Pyr3]-Amyloid β-Protein (3-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C196H299N53O55SMolecular weight:4,309.97 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H108N22O16Molecular weight:1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C205H340N60O53Molecular weight:4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H71N13O15Molecular weight:1,070.18 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H150N26O31SMolecular weight:2,172.46 g/molSer-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H71N13O14S2Molecular weight:1,046.24 g/mol[Tyr27]-pTH (27-48) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C104H159N29O31Molecular weight:2,311.60 g/mol[Glu3,4,7,10,14]-Conantokin G
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H137N25O35Molecular weight:2,045.16 g/molMMP-8 Substrate, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H63N13O13Molecular weight:1,042.14 g/molHIV-1, HIV-2 Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H80N12O14Molecular weight:1,145.3 g/molβ-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C23H28N4O4Molecular weight:424.50 g/mol[D-Trp2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H43N7O6SMolecular weight:701.85 g/molParathyroid Hormone (1-34)-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C197H317N59O54S3Molecular weight:4,472.26 g/molAntioxidant peptide B
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H91N17O15Molecular weight:1,254.47 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formula:C184H282N56O53S2Molecular weight:4,190.77 g/molTNF-α (46-65) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H172N24O30Molecular weight:2,310.74 g/molβ-Endorphin (27-31) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H45N7O9Molecular weight:623.71 g/molgp120, HIV-1 MN
<p>Catalogue peptide; min. 95% purity</p>Formula:C135H221N45O33Molecular weight:3,002.55 g/molBiotin-Phosphorylated MBP (94-102)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H85N20O15SMolecular weight:1,273.41 g/molMMP-3 Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H61N13O13SMolecular weight:1,012.13 g/mol[D-Ala4]-Substance P (4-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H65N11O10SMolecular weight:940.14 g/molPRRS-PQGAB-M
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H80N16O23Molecular weight:1,309.32 g/molInfluenza A M2 coat protein (22-46)
<p>Catalogue peptide; min. 95% purity</p>Formula:C129H215N31O33Molecular weight:2,728.34 g/molMagainin Spacer Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H150N28O39Molecular weight:2,332.39 g/mol6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt
CAS:<p>Please enquire for more information about 6-FAM-(Glu13·17·20)-Osteocalcin (1-46) (mouse) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C247H361N57O80S2Purity:Min. 95%Molecular weight:5,472.98 g/molBiotin-Neuromedin S (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H87N15O14Molecular weight:1,326.53 g/molNTB (Naltriben)
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H65N11O11S2Molecular weight:1,060.29 g/mol[Tyr8,Nle11] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C64H100N18O14Molecular weight:1,345.62 g/mol5A/5B Peptide (1)
<p>Catalogue peptide; min. 95% purity</p>Formula:C46H72N10O18S2Molecular weight:1,117.24 g/molTNF-α(10-36) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C131H211N43O38Molecular weight:2,996.41 g/molβ-Amyloid (31-35)
<p>Catalogue peptide; min. 95% purity</p>Formula:C25H47N5O6SMolecular weight:545.75 g/mol[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)
<p>Catalogue peptide; min. 95% purity</p>Molecular weight:1,049.3 g/molFmoc-N-Me-D-Arg(Mtr)-OH
CAS:<p>Please enquire for more information about Fmoc-N-Me-D-Arg(Mtr)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C32H38N4O7SPurity:Min. 95%Molecular weight:622.73 g/molLeucokinin V
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H46N10O11Molecular weight:782.8 g/molCaspase 3 Substrate, chromogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C27H39N7O10Molecular weight:621.66 g/molH-Glu-Ala-OH
CAS:<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br>br><br>br>br><br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>Formula:C8H14N2O5Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:218.21 g/molXenopsin (XP)
<p>Catalogue peptide; min. 95% purity</p>Formula:C47H73N13O10Molecular weight:980.20 g/molα-Conotoxin EI
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H123N27O27S5Molecular weight:2,091.39 g/molAT1A, Angiotensin II receptor, (225-237)
<p>Catalogue peptide; min. 95% purity</p>Formula:C67H107N21O24Molecular weight:1,590.73 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H36N8O11Molecular weight:588.58 g/molGlycoprotein IIb Fragment (656-667)
<p>Catalogue peptide; min. 95% purity</p>Formula:C57H90N18O18SMolecular weight:1,347.53 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H81N21O17Molecular weight:1,236.32 g/molPlatelet-Derived Growth Factor Receptor Substrate 2
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H86N13O22PMolecular weight:1,300.36 g/molGlutaryl-Phe-AMC
CAS:<p>Glutaryl-Phe-AMC is a fluorophore that has been used to study dental plaque. It is an amide of glutaryl-Phe and AMC, which is a water molecule. Glutaryl-Phe-AMC is a synthetic molecule that can be deprotonated by histidine in the presence of d-homoserine. The fluorescence of this compound increases when it binds to the enzyme substrates, 7-amino-4-methylcoumarin (AMC) and water molecules. This assay can be used for studying proteolytic activity on enzymes such as protease and amylase.</p>Formula:C24H24N2O6Purity:Min. 95%Molecular weight:436.46 g/molIL34 Human, His
<p>IL34 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 260 amino acids (21-242 a.a) and having a molecular mass of 29.6kDa. IL34 is fused to a 38 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.</p>Purity:Min 85% By Sds-Page.RS domain derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C44H85N25O15Molecular weight:1,204.33 g/molα-Casein (90-95)
<p>Catalogue peptide; min. 95% purity</p>Formula:C103H175N35O27SMolecular weight:2,367.83 g/molHPV-E6-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H128N24O25SMolecular weight:1,810.07 g/molGhrelin-[Cys(AF647)] Human
<p>Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.</p>Purity:Min. 95%Molecular weight:4,326.9 g/molSynapsin I-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H91N21O14Molecular weight:1,246.45 g/molHIV-gp120-41-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H164N32O31SMolecular weight:2,534.86 g/molDok-5 (263-275)
<p>Catalogue peptide; min. 95% purity</p>Formula:C75H114N24O19Molecular weight:1,655.89 g/molH-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Trp-Phe-Tyr-Ser(PO3H2)-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C53H62N11O13PPurity:Min. 95%Molecular weight:1,092.1 g/molHPV-E7-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C108H159N23O39S2Molecular weight:2,467.72 g/molPDGFRtide
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H76N10O20Molecular weight:1,185.26 g/molH-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH
<p>Peptide H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>MMP Substrate I, fluorogenic
<p>Catalogue peptide; min. 95% purity</p>Formula:C45H64N14O11Molecular weight:977.1 g/molAdrenomedullin (1-52), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C264H406N80O77S3Molecular weight:6,028.72 g/molFibrinopeptide B
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H93N19O25Molecular weight:1,552.60 g/mol
![[Pro18, Asp21] β-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[Pro34]-Neuropeptide Y, human, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00912.webp&w=3840&q=75)
![[Pyr11]-Amyloid β-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Pyr3]-Amyloid β-Protein (3-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00174.webp&w=3840&q=75)
![[Tyr27]-pTH (27-48) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00893.webp&w=3840&q=75)
![[Glu3,4,7,10,14]-Conantokin G](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00410.webp&w=3840&q=75)
![[D-Trp2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00844.webp&w=3840&q=75)
![[D-Ala4]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00136.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[D-Phe7, D-Trp10]-Somatostatin 14 (7-14)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00141.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![Ghrelin-[Cys(AF647)] Human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1110382.webp&w=3840&q=75)
