Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30478 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Kemptide Negative Control
<p>Catalogue peptide; min. 95% purity</p>Formula:C32H61N13O8Molecular weight:755.93 g/molPrepro-Nerve Growth Factor (99-115) (mouse)
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H139N27O26Molecular weight:2,003.25 g/molBPDEtide [RKISASEFDRPLR]
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H115N23O20Molecular weight:1,574.82 g/molDAP10 Signaling Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C74H118N22O24SMolecular weight:1,731.96 g/molBiotin-Calcitonin (salmon I)
<p>Catalogue peptide; min. 95% purity</p>Formula:C155H254N46O50S3Molecular weight:3,658.22 g/mol[Tyr0]-pTH-Related Protein (1-34) (human, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C189H296N58O50Molecular weight:4,180.79 g/molAngiotensin II type 1 receptor (181-187), AT1, ATE.
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H52N10O13Molecular weight:880.92 g/molMMP-2/MMP-9 Inhibitor III
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H73N13O14S2Molecular weight:1,168.35 g/mol[D-Trp2,7,9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C80H109N21O13SMolecular weight:1,604.96 g/mol[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)
<p>Catalogue peptide; min. 95% purity</p>Formula:C102H152N26O29Molecular weight:2,206.51 g/molFMRF-related peptide, SDPFLRF-NH2
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H61N11O10Molecular weight:880.02 g/mol[Gln11]-β-Amyloid (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C194H296N54O57SMolecular weight:4,328.91 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H116N24O22Molecular weight:1,633.84 g/molAdrenomedullin (13-52), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C200H308N58O59S2Molecular weight:4,533.17 g/mol[Ala3,11,18, Nle7] Endothelin-1, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C109H161N25O29S2Molecular weight:2,349.78 g/molACTH (18-39) (human) (Adrenocorticotropic Hormone) (Biotin)
<p>Catalogue peptide; min. 95% purity</p>Formula:C122H179N29O38Molecular weight:2,659.89 g/molDelicious Peptide
CAS:<p>Catalogue peptide; min. 95% purity</p>Formula:C34H57N9O16Molecular weight:847.88 g/molβ-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H102N16O21SMolecular weight:1,403.63 g/molCDC25C
<p>Catalogue peptide; min. 95% purity</p>Formula:C115H198N40O33SMolecular weight:2,701.17 g/molβ-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H113N19O19Molecular weight:1,500.77 g/molGalanin (1-13)-Spantide I
<p>Catalogue peptide; min. 95% purity</p>Formula:C138H199N35O30Molecular weight:2,828.34 g/mol[Ala2] Met-Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C28H38N6O6SMolecular weight:586.72 g/molBTK derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H115N17O18S2Molecular weight:1,570.95 g/molOV-2, Sheep
<p>Catalogue peptide; min. 95% purity</p>Formula:C84H159N29O14Molecular weight:1,799.39 g/mol[Gln11]-β-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H210N42O45Molecular weight:3,261.54 g/mol[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H82N14O18Molecular weight:1,179.31 g/mol[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C73H92N18O16S2Molecular weight:1,541.79 g/molSaposin C22
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H196N28O37SMolecular weight:2,607.02 g/molFibronectin Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C29H51N11O11Molecular weight:729.80 g/molβ I probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C81H116N26O24Molecular weight:1,873.99 g/mol[Lys8,Lys9]-Neurotensin (8-13)
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H64N8O8Molecular weight:760.98 g/molGIP, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C225H342N60O66SMolecular weight:4,975.66 g/molPeptide Lv (rat) trifluoroacetate salt
CAS:<p>Please enquire for more information about Peptide Lv (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C262H415N73O72S2Purity:Min. 95%Molecular weight:5,803.68 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
<p>Catalogue peptide; min. 95% purity</p>Formula:C216H343N67O60Molecular weight:4,838.43 g/molFmoc-Val-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Val-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%[D-Ala2,Leu5,Arg6] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H51N9O8Molecular weight:725.85 g/mol234 CM
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H69N11O14S3Molecular weight:1,048.26 g/mol[Asp5,6,Me-Phe8] Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H56N8O11SMolecular weight:857.00 g/mol[D-Met2,Pro5] Enkephalin, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C30H40N6O6SMolecular weight:612.75 g/molPRRS-RSAB-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H61N11O18Molecular weight:1,020.03 g/molDoc-6 (130-145)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H134N26O26SMolecular weight:1,980.25 g/molδ1-MSH, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H97N21O14SMolecular weight:1,512.8 g/molPACAP(1-38)-Lys(Biotin), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C219H357N67O56S2Molecular weight:4,888.83 g/molBradykinin-Like Neuropeptide (3-11) (Aplysia californica)
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H77N21O12Molecular weight:1,068.22 g/molBig Endothelin-1 (22-39), rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C83H135N25O27Molecular weight:5,511 g/mol[Val35] -β-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C203H311N55O60Molecular weight:4,481.96 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Molecular weight:1,745.99 g/mol[Lys0]-γ-1-MSH (41-58), amide
<p>Catalogue peptide; min. 95% purity</p>Molecular weight:1,641.1 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H97N21O16S1Molecular weight:1,424.66 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C79H125N23O28SMolecular weight:1,877.08 g/molPrepro-Neuromedin U (104-136) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C177H277N47O45Molecular weight:3,783.47 g/molCC Chemokine Receptor 3 Fragment I, amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C142H223N35O53S2Molecular weight:3,332.68 g/molβ-Interleukin I (163-171), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H64N12O19Molecular weight:1,005.01 g/molDynorphin A (1-11), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H103N21O13Molecular weight:1,362.66 g/molβ-Defensin-3, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C216H371N75O59S6Molecular weight:5,155.22 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H54N8O10Molecular weight:782.90 g/molDynorphin A (3-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C64H114N22O12Molecular weight:1,383.76 g/molAmyloid Dan Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formula:C185H268N48O51S2Molecular weight:4,044.63 g/molPlatelet-Derived Growth Factor Receptor Substrate 1
<p>Catalogue peptide; min. 95% purity</p>Formula:C52H81N12O19PMolecular weight:1,209.29 g/molMARCKS Substrate (151-175)
<p>Catalogue peptide; min. 95% purity</p>Formula:C147H246N41O40P3Molecular weight:3,320.78 g/molAdipokinetic Hormone II Locusta Migratoria
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H57N11O11Molecular weight:904.02 g/molGastric Inhibitory Polypeptide (1-30) (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C162H244N40O48SMolecular weight:3,551.97 g/molZ-D-Phe-Phe-Gly-OH
CAS:<p>Z-D-Phe-Phe-Gly-OH is a lysosomal carboxypeptidase that hydrolyzes peptides at the C terminus of proteins. It has a wide substrate specificity and can hydrolyze Z-D-Phe-Phe-Gly, Z-Arg-Lys, and L-Arg. This enzyme has been shown to have ion exchange chromatography activity. The elution profile for this enzyme on a sephadex G-100 column was found to have an optimum pH of 7.5 and elutes at a salt concentration of 0.5M NaCl. Carboxypeptidases are enzymes that cleave at the C terminus of proteins to produce smaller peptides or amino acids. They are involved in digestion, blood clotting, and cell signaling processes.</p>Formula:C28H29N3O6Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:503.55 g/molLocustachykinin I
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H63N13O11Molecular weight:938 g/molLKRApYLG-NH2
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H67N12O11PMolecular weight:899.03 g/mol[Tyr1]-Adipokinetic Hormone, locust
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H78N14O15Molecular weight:1,211.5 g/molAc-Adhesin (1025-1044) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C97H160N26O32Molecular weight:2,202.51 g/molDynorphin A (2-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C90H146N30O21Molecular weight:1,984.36 g/mol[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formula:C80H122N22O19Molecular weight:1,696 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H107N21O22Molecular weight:1,450.63 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molLys-(Hyp3)-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H85N17O13Molecular weight:1,204.41 g/molBiotin-Secretin, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H234N46O42SMolecular weight:5,465.80 g/molAmyloid Bri Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Formula:C173H275N49O52S2Molecular weight:3,937.55 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formula:C107H141N22O37PS2Molecular weight:2,422.53 g/molFmoc-Gly-Cys(Psi(Dmp,H)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Gly-Cys(Psi(Dmp,H)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C29H28N2O7SPurity:Min. 95%Molecular weight:548.61 g/molFluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Fluorescein-6-carbonyl-Val-Glu(OMe)-Ile-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C44H49FN4O14Purity:Min. 95%Molecular weight:876.88 g/molβ-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H209N41O46Molecular weight:3,262.53 g/molβ-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H126N24O21S2Molecular weight:1,896.22 g/molα-Bag Cell Peptide (1-9)
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H83N15O12Molecular weight:1,122.35 g/molpp60(v-SRC) Autophosphorylation Site, Tyrosine Phosphopeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H110N23O27PMolecular weight:1,672.74 g/mol(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin
CAS:<p>(1-Adamantaneacetyl1,D-Tyr(Et)2,Val4, Abu 6, Arg8·9)-vasopressin is a vasopressor analog that has been shown to be an effective treatment for congestive heart failure by acting as an agonist at the V1 receptor. It has been shown to stimulate cyclase activity and increase levels of adenosine 3',5'-cyclic monophosphate (cAMP). This drug also stimulates the production of immunoglobulin A antibodies in mice and increases the expression of leucine aminopeptidase and immunofluorescence in rat kidney cells. Vasopressin analogs are used primarily for their vasoconstrictive properties.</p>Formula:C62H94N16O11Purity:Min. 95%Color and Shape:White Off-White PowderMolecular weight:1,239.51 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C219H365N73O66SMolecular weight:5,108.86 g/molAmyloid b-Protein (1-42) (mouse, rat)
CAS:<p>Please enquire for more information about Amyloid b-Protein (1-42) (mouse, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C199H307N53O59SPurity:Min. 95%Molecular weight:4,417.95 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H108N22O16Molecular weight:1,453.72 g/molLL-37, Antimicrobial Peptide, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C205H340N60O53Molecular weight:4,493.37 g/molC. difficile Toxin B (529-536)
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H71N13O15Molecular weight:1,070.18 g/molβ II probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C94H150N26O31SMolecular weight:2,172.46 g/mol1-(Fmoc-aminomethyl)-b-D-galacturonic acid
CAS:<p>Please enquire for more information about 1-(Fmoc-aminomethyl)-b-D-galacturonic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C22H23NO8Purity:Min. 95%Molecular weight:429.42 g/molAc-Ala-Ala-Ala-pNA
CAS:<p>Ac-Ala-Ala-Ala-pNA is a synthetic peptide that is derived from the natural amino acid sequence of cholecystokinin. It has been shown to have high affinity for phospholipid bilayers, which are lipid membranes that form the boundaries of cells and organelles. Ac-Ala-Ala-Ala-pNA can be used as a substrate molecule to study membrane permeability and selectivity in bioreactors. Ac-Ala-Ala-Ala-pNA also acts as a modulator of liposomal membranes, increasing the permeability of these membranes in order to allow more substrate molecules to pass through them.</p>Formula:C17H23N5O6Purity:Min. 95%Color and Shape:PowderMolecular weight:393.39 g/molH-Gly-Glu-Gly-OH trifluoroacetic acid
CAS:<p>H-Gly-Glu-Gly-OH trifluoroacetic acid is a dilute buffer solution of amino acids. It has been used to study the thermodynamic stability of polypeptides and their sensitivity to acidic conditions. Experiments have shown that H-Gly-Glu-Gly-OH trifluoroacetic acid is more stable than glycine, glutamic acid, histidine, aspartic acid, or aspartyl. This compound is an amino acid with a high concentration of glutamic acid.</p>Formula:C9H15N3O6•(CF3CO2H)xPurity:Min. 95%Molecular weight:261.23 g/molIsocyanomethyl resin (200-400 mesh)
<p>Please enquire for more information about Isocyanomethyl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Color and Shape:PowderH-Gly-2-chlorotrityl resin (200-400 mesh)
CAS:<p>Please enquire for more information about H-Gly-2-chlorotrityl resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Ser-Ala-SAP-IIB
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H71N13O14S2Molecular weight:1,046.24 g/molH-Lys-Ala-OH hydrobromide
CAS:<p>Lysine is an essential amino acid, which means that it cannot be synthesized by the body and must be obtained from food. It is a crucial component of many proteins, including enzymes and hormones. Lysine is also involved in calcium absorption, maintaining nitrogen balance, and the production of carnitine. Lysine hydrobromide is a salt form of lysine that can be used to inhibit protein synthesis in bacteria. This inhibition can take place at either the transcriptional or translational level, but not both simultaneously. The inhibition of protein synthesis prevents the cell from growing and reproducing. Lysine hydrobromide has been shown to have a regulatory effect on enzyme activities in corynebacterium glutamicum (a type of bacteria). It also acts as a substrate for uptake by corynebacterium glutamicum cells due to its high lysine content.</p>Formula:C9H19N3O3·HBrPurity:Min. 95%Color and Shape:PowderMolecular weight:298.18 g/mol
![BPDEtide [RKISASEFDRPLR]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00667.webp&w=3840&q=75)
![[Tyr0]-pTH-Related Protein (1-34) (human, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00858.webp&w=3840&q=75)
![[D-Trp2,7,9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00654.webp&w=3840&q=75)
![[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00427.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[Ala3,11,18, Nle7] Endothelin-1, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00286.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[Gln11]-β-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Val671]-Amyloid b/A4 Protein Precursor770 (667-676)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00712.webp&w=3840&q=75)
![[Des-Ala1,des-Gly2,His4,5,D-Trp8]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00275.webp&w=3840&q=75)
![[Lys8,Lys9]-Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00532.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Asp5,6,Me-Phe8] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00320.webp&w=3840&q=75)
![[D-Met2,Pro5] Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00841.webp&w=3840&q=75)
![[Val35] -β-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr1]-Adipokinetic Hormone, locust](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00892.webp&w=3840&q=75)
![[Trp11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00192.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
