Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 29634 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
| Brand | Product data | Purity | Price range | Estimated delivery |
|---|---|---|---|---|
 | Biotin-LC-Neurogranin (28-43) REF: 3D-VAC-00065 | - - - | 195,00€ ∼ 696,00€ | Discontinued product |
| Proinsulin C-peptide (55-89), human REF: 3D-VAC-00682 | - - - | 429,00€ ∼ 1.705,00€ | Discontinued product |
| IL34 Human, His REF: 3D-CYT-042 | Min 85% By Sds-Page. | 194,00€ ∼ 1.202,00€ | Discontinued product |
| Biotin-Neurokinin B REF: 3D-VAC-00082 | - - - | 351,00€ ∼ 925,00€ | Discontinued product |
| Tachykinin (111-129) Beta-Prepro (Human) REF: 3D-VAC-00234 | - - - | 188,00€ ∼ 743,00€ | Discontinued product |
| P60c-src Substrate II, Phosphorylated REF: 3D-VAC-00034 | - - - | 255,00€ ∼ 710,00€ | Discontinued product |
| beta-Casomorphin (1-3) amide REF: 3D-VAC-00901 | - - - | 202,00€ ∼ 562,00€ | Discontinued product |
| Melanotan II, MT-Ⅱ REF: 3D-VAC-00018 | - - - | 213,00€ ∼ 533,00€ | Discontinued product |
| C-Reactive Protein (CRP) (77-82) REF: 3D-VAC-00793 | - - - | 181,00€ ∼ 503,00€ | Discontinued product |
| GAD65 (78-97) REF: 3D-VAC-00543 | - - - | 195,00€ ∼ 771,00€ | Discontinued product |
| [D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11) REF: 3D-VAC-00148 | - - - | 202,00€ ∼ 799,00€ | Discontinued product |
| [Tyr27]-pTH (27-48) (human) REF: 3D-VAC-00893 | - - - | 216,00€ ∼ 855,00€ | Discontinued product |
| Adrenomedullin (1-52), human REF: 3D-VAC-00919 | - - - | 625,00€ ∼ 2.716,00€ | Discontinued product |
| Saposin C18 REF: 3D-VAC-00798 | - - - | 207,00€ ∼ 740,00€ | Discontinued product |
| [D-Phe7] a-MSH, amide REF: 3D-VAC-00051 | - - - | 429,00€ ∼ 1.136,00€ | Discontinued product |
| [Phe1376]-Fibronectin Fragment (1371-1382) REF: 3D-VAC-00679 | - - - | 137,00€ ∼ 488,00€ | Discontinued product |
| abIII probe REF: 3D-VAC-00750 | - - - | 174,00€ ∼ 622,00€ | Discontinued product |
| α-Neo-Endorphin Analog REF: 3D-VAC-00869 | - - - | 351,00€ ∼ 1.038,00€ | Discontinued product |
| beta-Defensin-3, human REF: 3D-VAC-00429 | - - - | 1.234,00€ ∼ 6.010,00€ | Discontinued product |
| Kinase Domain of Insulin Receptor (3) REF: 3D-VAC-00772 | - - - | 213,00€ ∼ 841,00€ | Discontinued product |
| Myelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate REF: 3D-FM109206 CAS: 149635-73-4 | Min. 95% | 315,00€ ∼ 701,00€ | Discontinued product |
| H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH REF: 3D-PP47266 | - - - | 917,00€ ∼ 2.346,00€ | Discontinued product |
| SALMF amide 2 (S2) REF: 3D-VAC-00720 | - - - | 359,00€ ∼ 1.010,00€ | Discontinued product |
| Prolactin Releasing Peptide (12-31), bovine REF: 3D-VAC-00767 | - - - | 206,00€ ∼ 813,00€ | Discontinued product |
| Corticostatin, human REF: 3D-VAC-00788 | - - - | 406,00€ ∼ 1.612,00€ | Discontinued product |
| HIV-gp41-Antigenic Peptide 5 REF: 3D-VAC-00698 | - - - | 479,00€ ∼ 1.903,00€ | Discontinued product |
| GLP-2 (rat) REF: 3D-VAC-00465 | - - - | 406,00€ ∼ 1.612,00€ | Discontinued product |
| RES-701-1 REF: 3D-VAC-00439 | - - - | 209,00€ ∼ 827,00€ | Discontinued product |
| Dynorphin A (2-13), porcine REF: 3D-VAC-00416 | - - - | 351,00€ ∼ 925,00€ | Discontinued product |
| H-ASCLYGQLPK-OH REF: 3D-PP42775 | - - - | 242,00€ ∼ 460,00€ | Discontinued product |
| Cerebellin trifluoroacetate REF: 3D-BC184180 CAS: 94071-26-8 | Min. 95% | 322,00€ ∼ 1.802,00€ | Discontinued product |
| Angiotensin A (1-7) trifluoroacetate REF: 3D-FA110097 CAS: 1176306-10-7 | Min. 95% | 179,00€ ∼ 1.245,00€ | Discontinued product |
| H-GILGFVFTL-OH REF: 3D-PP48052 CAS: 141368-69-6 | - - - | 226,00€ ∼ 473,00€ | Discontinued product |
| Coibamide A REF: 3D-BC183236 CAS: 1029227-48-2 | Min. 95% | To inquire | Discontinued product |