Peptides
Subcategories of "Peptides"
Found 29635 products of "Peptides"
Allatostatin I (free acid)
Catalogue peptide; min. 95% purity
Formula:C61H94N18O16Molecular weight:1,335.5 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Molecular weight:560.61 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formula:C90H136N22O28S2Molecular weight:2,038.34 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Molecular weight:1,406.62 g/molBCIP dipotassium
CAS:BCIP (5-bromo-4-chloro-3-indolyl phosphate) dipotassium is a chromogenic substrate commonly used for the detection of the enzymatic activity of alkaline phosphatase. Upon dephosphorylation by alkaline phosphatase, BCIP produces a blue precipitate, which can be easily visualized. This substrate has various uses, including the detection of gene expression in molecular biology, the identification of alkaline phosphatase activity in clinical pathology, and the detection of protein-protein interactions in biochemistry. Its long-term stability in solution makes it a common choice for many applications.
Formula:C8H4BrClK2NO4PPurity:Min. 98 Area-%Color and Shape:PowderMolecular weight:402.65 g/molRef: 3D-EB110885
Discontinued productAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Molecular weight:3,935.55 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Molecular weight:1,770.34 g/molBiotin-Angiotensin I, human
Catalogue peptide; min. 95% purity
Formula:C72H103N19O16SMolecular weight:1,522.81 g/molbeta-Amyloid (1-34)
Catalogue peptide; min. 95% purity
Formula:C170H253N47O52Molecular weight:3,787.20 g/molN-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide
CAS:Please enquire for more information about N-(3-Amino-2-hydroxy-3-oxopropyl)-L-valyl-N-phenyl-L-leucinamide including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C20H32N4O4Purity:Min. 95%Color and Shape:PowderMolecular weight:392.49 g/molMSP-1 P2, Malaria Merozoite Surface Peptide-1
Catalogue peptide; min. 95% purity
Formula:C116H190N32O35SMolecular weight:2,625 g/molAmyloid beta-Protein (25-35) amide
Catalogue peptide; min. 95% purity
Formula:C45H82N14O13SMolecular weight:1,059.31 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Molecular weight:1,326.53 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C53H80N20O18Purity:Min. 95%Molecular weight:1,285.3 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Molecular weight:1,345.62 g/molHypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C180H287N57O48Molecular weight:4,017.55 g/molADP-Ribosylation Factor 6, ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C60H102N16O17Molecular weight:1,319.58 g/molAc-Adhesin (1025-1044) amide
Catalogue peptide; min. 95% purity
Formula:C97H160N26O32Molecular weight:2,202.51 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molRef: 3D-FS109491
Discontinued productBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
Catalogue peptide; min. 95% purity
Formula:C107H141N22O37PS2Molecular weight:2,422.53 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molDynorphin A (3-13), porcine
Catalogue peptide; min. 95% purity
Formula:C64H114N22O12Molecular weight:1,383.76 g/molAmyloid Dan Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C185H268N48O51S2Molecular weight:4,044.63 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SMolecular weight:1,159.45 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Molecular weight:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[Cit5]-TRAP-5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00717.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![Biotin-[Glu1]-Gastrin I (human) (phosphorylated)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00087.webp&w=3840&q=75)
