Peptides
Subcategories of "Peptides"
Found 29793 products of "Peptides"
SALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Molecular weight:1,275.4 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formula:C40H51N5O18P2Molecular weight:951.86 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formula:C130H221N37O35SMolecular weight:2,894.43 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Molecular weight:2,182.53 g/molCecropin A (1-7)-Melittin A (2-9) amide
Catalogue peptide; min. 95% purity
Formula:C89H152N22O15Molecular weight:1,770.34 g/molAmyloid Bri Protein (1-34)
Catalogue peptide; min. 95% purity
Formula:C173H273N49O52S2Molecular weight:3,935.55 g/mol[D-Tyr11]-Neurotensin
Catalogue peptide; min. 95% purity
Formula:C78H121N21O20Molecular weight:1,673 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)
Catalogue peptide; min. 95% purity
Formula:C58H77N13O10Molecular weight:1,116.34 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Molecular weight:3,709.03 g/molAntioxidant peptide A
Catalogue peptide; min. 95% purity
Formula:C31H54N12O7S2Molecular weight:770.97 g/molC-Reactive Protein (CRP) (77-82)
Catalogue peptide; min. 95% purity
Formula:C23H40N6O10Molecular weight:560.61 g/molAc-Endothelin-1 (16-21), human
Catalogue peptide; min. 95% purity
Formula:C41H59N9O10Molecular weight:837.98 g/mol[Met2]-Deltorphin
Catalogue peptide; min. 95% purity
Formula:C44H62N10O10S2Molecular weight:955.17 g/molCalcitonin (8-32) (salmon I)
Catalogue peptide; min. 95% purity
Formula:C119H198N36O37Molecular weight:2,725.06 g/molRnase (90-105)
H-SKYPNCAYKTTQANKH-OH peptide, corresponding to RNase A 90-105 (Chain A of bovine pancreatic ribonuclease); min. 95% purity
Formula:C80H124N24O25SMolecular weight:1,854.08 g/molp3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54-68)
Catalogue peptide; min. 95% purity
Formula:C59H97N17O19Molecular weight:1,348.53 g/molFas C-Terminal Tripeptide
Catalogue peptide; min. 95% purity
Formula:C16H29N3O6Molecular weight:359.43 g/molBiotin-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C60H87N17O13SMolecular weight:1,286.53 g/molα-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)
Catalogue peptide; min. 95% purity
Formula:C18H33N5O4Molecular weight:383.49 g/molFMRF-related peptide, Lymnaea heptapeptide
Catalogue peptide; min. 95% purity
Formula:C41H59N11O9Molecular weight:850.00 g/molbeta-Amyloid (7-22)
Catalogue peptide; min. 95% purity
Formula:C88H124N22O26Molecular weight:2,466 g/mol(D-Ala2)-GRF (1-29) amide (human)
CAS:Please enquire for more information about (D-Ala2)-GRF (1-29) amide (human) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C149H246N44O42SPurity:Min. 95%Molecular weight:3,357.88 g/molRef: 3D-FA109070
Discontinued productUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formula:C44H66N14O10SMolecular weight:983.17 g/mol[Tyr0]-Hypercalcemia Malignancy Factor (1-40)
Catalogue peptide; min. 95% purity
Formula:C216H343N67O60Molecular weight:4,838.43 g/mol[Gln11]-beta-Amyloid (1-28)
Catalogue peptide; min. 95% purity
Formula:C145H210N42O45Molecular weight:3,261.54 g/molBAD (103-127), human
Catalogue peptide; min. 95% purity
Formula:C137H212N42O39SMolecular weight:3,103.54 g/mol[Ala2] Met-Enkephalin, amide
Catalogue peptide; min. 95% purity
Formula:C28H38N6O6SMolecular weight:586.72 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
Catalogue peptide; min. 95% purity
Formula:C15H28N4O5Molecular weight:344.41 g/mol[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)
Catalogue peptide; min. 95% purity
Formula:C28H36N6O6Molecular weight:552.64 g/molPannexin-1 Fragment (4515)
Catalogue peptide; min. 95% purity
Formula:C59H104N22O20Molecular weight:1,441.62 g/molP69 (522-534), M. leprae
Catalogue peptide; min. 95% purity
Formula:C52H84N14O21Molecular weight:1,241.33 g/molCEA Related, TYACFVSNL
Catalogue peptide; min. 95% purity
Formula:C46H68N10O14SMolecular weight:1,017.17 g/molHBVpol655, HBV polymerase (655-663)
Catalogue peptide; min. 95% purity
Formula:C46H75N9O11S2Molecular weight:994.28 g/molPrésure. 10. 145-148
Catalogue peptide; min. 95% purity
Formula:C46H59N7O12Molecular weight:902.02 g/molBiotin-Insulin Receptor (1142-1153), amide
Catalogue peptide; min. 95% purity
Formula:C82H122N22O25SMolecular weight:1,848.08 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Molecular weight:1,543.77 g/mol[Ala144]-PLP (139-151) A144-PLP(139-151)
Catalogue peptide; min. 95% purity
Formula:C64H99N19O17Molecular weight:1,406.62 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formula:C35H41N5O12Molecular weight:723.7 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111733
Discontinued productP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molBrain injury Derived Neurotrophic Peptide(3) BINP
Catalogue peptide; min. 95% purity
Formula:C62H101N17O19Molecular weight:1,388.58 g/mol[Gln11]-beta-Amyloid (1-40)
Catalogue peptide; min. 95% purity
Formula:C194H296N54O57SMolecular weight:4,328.91 g/molFMRF-related peptide, SDPFLRF-NH2
Catalogue peptide; min. 95% purity
Formula:C42H61N11O10Molecular weight:880.02 g/molInfluenza HA (529-537)
Catalogue peptide; min. 95% purity
Formula:C41H67N9O13Molecular weight:894.04 g/molKGF Receptor Peptide
Catalogue peptide; min. 95% purity
Formula:C114H174N30O42SMolecular weight:2,668.90 g/molTNF-α (72-82), human
Catalogue peptide; min. 95% purity
Formula:C48H86N18O16Molecular weight:1,171.33 g/mol[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human
Catalogue peptide; min. 95% purity
Formula:C189H285N55O57SMolecular weight:4,271.67 g/molH-Ser-Ile-Lys-Val-Ala-Val-OH
CAS:H-Ser-Ile-Lys-Val-Ala-Val-OH is a peptide that is synthesized from the amino acid sequence of the human skin cells. It has been shown to be effective in inhibiting bacterial growth and inducing death in bacteria. This peptide binds to the bacterial cell wall and inhibits its growth. The polymer film can be used for the delivery of H-Ser-Ile-Lys-Val-Ala-Val-OH in the form of lamellar, galacturonic acid, collagen, or lipid nanoparticles. The lamellar phase can be prepared by using water as solvent and lipids as surfactant. The lipid nanoparticle formulation consists of a core material (e.g., cholesterol) surrounded by a lipid bilayer composed of phospholipids or glycolipids with H Ser Ile Lys Val Ala Val OH incorporated into it. This peptide has also been shown to have skin care properties when
Formula:C28H53N7O8Purity:Min. 95%Molecular weight:615.76 g/molRef: 3D-FS108741
Discontinued productGAP 26 trifluoroacetate salt
CAS:13-mer connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.Formula:C70H107N19O19SPurity:Min. 95%Molecular weight:1,550.78 g/molRef: 3D-FG110169
Discontinued productGnT-V (nt38-67)
Catalogue peptide; min. 95% purity
Formula:C54H89N13O13SMolecular weight:1,159.45 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Molecular weight:1,345.62 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Molecular weight:1,326.53 g/molPKA Inhibitor Substrate
Catalogue peptide; min. 95% purity
Formula:C61H108N25O22PMolecular weight:1,574.69 g/mol[Ala5, beta-Ala8]-Neurokinin A (4-10)
Catalogue peptide; min. 95% purity
Formula:C35H56N8O9SMolecular weight:765 g/mol[Pyr6]-Substance P (6-11)
Catalogue peptide; min. 95% purity
Formula:C36H49N7O7SMolecular weight:723.91 g/molgp120, HIV-1 MN
Catalogue peptide; min. 95% purity
Formula:C135H221N45O33Molecular weight:3,002.55 g/mol[Pyr11]-Amyloid beta-Protein (11-40)
Catalogue peptide; min. 95% purity
Formula:C143H226N38O39SMolecular weight:3,133.71 g/molbeta-Amyloid/A4 Protein Precusor (APP) (319-335)
Catalogue peptide; min. 95% purity
Formula:C86H151N31O26S2Molecular weight:2,099.48 g/molbeta-Lipotropin (61-64)
Catalogue peptide; min. 95% purity
Formula:C22H26N4O6Molecular weight:442.48 g/molAloc-DL-Orn (Boc)-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Aloc-DL-Orn (Boc)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C14H24N2O6·C12H23NPurity:Min. 95%Molecular weight:497.67 g/molRef: 3D-FA107927
Discontinued productNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Molecular weight:1,564.86 g/molAc-Choline Receptor α1(129-145)
Catalogue peptide; min. 95% purity
Formula:C90H136N22O28S2Molecular weight:2,038.34 g/molMC-Gly-Gly-Phe-Gly-NH-CH2-O-CH2COOH
CAS:This activated peptide-cleavable linker has an extended functionality linked to the Gly in the peptide sequence. This is quite useful in conjugation in enzymatically cleavable environments inside target cells for controlled release of the drug or payload.
Formula:C28H36N6O10Purity:Min. 95%Molecular weight:616.6 g/molSomatostatin-28 (1-14)
Catalogue peptide; min. 95% purity
Formula:C61H105N23O21SMolecular weight:1,528.72 g/molAbz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp
CAS:Please enquire for more information about Abz-Val-Ala-Asp-Nva-Arg-Asp-Arg-Gln-EDDnp including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C53H80N20O18Purity:Min. 95%Molecular weight:1,285.3 g/mol[Phe1376]-Fibronectin Fragment (1371-1382)
Catalogue peptide; min. 95% purity
Formula:C63H103N25O19Molecular weight:1,514.68 g/mol[Trp11] Neurotensin (8-13)
Catalogue peptide; min. 95% purity
Formula:C40H65N13O7Molecular weight:840.05 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
Catalogue peptide; min. 95% purity
Formula:C62H97N21O16S1Molecular weight:1,424.66 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molH-D-Phe-pip-Arg-pna acetate
CAS:H-D-Phe-pip-Arg-pna acetate is an allosteric modulator that binds to the active site of thrombin. It inhibits activation of zymogen thrombin by binding to its receptor, thereby inhibiting clotting and coagulation. This compound has been shown to inhibit the activation of pyogenes by preventing the formation of fibrin clots, which are essential for bacterial growth. H-D-Phe-pip-Arg-pna acetate has also been shown to have an inhibitory effect on activated coagulation.
Formula:C27H36N8O5Purity:Min. 95%Molecular weight:552.6 g/molNps-Val-OH·DCHA
CAS:Controlled ProductPlease enquire for more information about Nps-Val-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C11H14N2O4S·C12H23NPurity:Min. 95%Molecular weight:451.62 g/molRef: 3D-FN107891
Discontinued productBig Gastrin-1, human
Catalogue peptide; min. 95% purity
Formula:C176H251N43O53SMolecular weight:3,849.30 g/molChorionic Gonadotropin-beta(109-119) amide (human)
Catalogue peptide; min. 95% purity
Formula:C51H76N16O21SMolecular weight:1,269.31 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formula:C40H72N12O13Molecular weight:929.09 g/molKinase Domain of Insulin Receptor (3)
Catalogue peptide; min. 95% purity
Formula:C72H108N19O27Molecular weight:1,702.77 g/molH-His-Arg-OH
CAS:H-His-Arg-OH is a synthetic peptide that has been shown to have cytotoxic effects on mammalian cells. The H-His-Arg-OH peptide can be used for the treatment of heart disease and autoimmune diseases, such as rheumatoid arthritis. This peptide has been found to be resistant to congestive heart failure, which is caused by a number of factors, including hypertension and valvular stenosis. It has also been shown to have an immunoglobulin G1 (IgG1) genotype.
Formula:C12H21N7O3Purity:Min. 95%Molecular weight:311.34 g/molRef: 3D-FH108062
Discontinued productrec IFN-gamma (human)
CAS:Controlled ProductPlease enquire for more information about rec IFN-gamma (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FR108523
Discontinued productZ-Gly-Gly-Trp-OH TFA
CAS:Please enquire for more information about Z-Gly-Gly-Trp-OH TFA including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C23H24N4O6•C2HF3O2Purity:Min. 95%Molecular weight:566.48 g/molRef: 3D-FG111473
Discontinued productH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Molecular weight:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[D-Pro4,D-Trp7,9,Nle11]-Substance P (4-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00148.webp&w=3840&q=75)
![[Met2]-Deltorphin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00898.webp&w=3840&q=75)
![α-Melanocyte Stimulating Hormone, acetylated-[D-Val13] (11-13) (MSHa)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00035.webp&w=3840&q=75)
![[Tyr0]-Hypercalcemia Malignancy Factor (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00857.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-28)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00315.webp&w=3840&q=75)
![[Ala2] Met-Enkephalin, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00854.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[D-Ala2]-beta-Casomorphin (1-5) amide (bovine)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00828.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Ala144]-PLP (139-151) A144-PLP(139-151)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00493.webp&w=3840&q=75)
![[Gln11]-beta-Amyloid (1-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00314.webp&w=3840&q=75)
![[D-Tyr27,36, D-Thr32]-Neuropeptide Y, human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00911.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Ala5, beta-Ala8]-Neurokinin A (4-10)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00317.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[Pyr11]-Amyloid beta-Protein (11-40)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00202.webp&w=3840&q=75)
![[Phe1376]-Fibronectin Fragment (1371-1382)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00679.webp&w=3840&q=75)
![[Trp11] Neurotensin (8-13)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00688.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
