Peptides
Subcategories of "Peptides"
Found 29796 products of "Peptides"
TNF-α (31-45), human
Catalogue peptide; min. 95% purity
Formula:C69H122N26O22Molecular weight:1,667.90 g/molBiotin-Gastrin (1-17)
Catalogue peptide; min. 95% purity
Formula:C107H140N22O34S2Molecular weight:2,342.56 g/mol[D-Phe7] a-MSH, amide
Catalogue peptide; min. 95% purity
Formula:C77H109N21O19SMolecular weight:1,664.92 g/molPalmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH
CAS:Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH is a synthetic cytochalasin that has been shown to have bactericidal activity against Gram-positive bacteria. It inhibits the growth of bacteria by binding to extracellular anions, such as diacylglycerol and aluminium ions. Palmitoyl-Cys((RS)-2,3-di(palmitoyloxy)-propyl)-OH also synergizes with phorbol esters and lipoprotein. This drug has been shown to be effective in treating human serum infections at doses of 100 µg/mL and higher.
Formula:C54H103NO7SPurity:Min. 95%Molecular weight:910.46 g/molRef: 3D-FP107899
Discontinued productBiotin-LC-Neurogranin (28-43)
Catalogue peptide; min. 95% purity
Formula:C94H159N31O20S2Molecular weight:2,139.48 g/molGAD65 (78-97)
Catalogue peptide; min. 95% purity
Formula:C97H148N26O29S2Molecular weight:2,206.53 g/molPACAP-27 (6-27) (human, chicken, mouse, ovine, porcine, rat)
CAS:Catalogue peptide; min. 95% purity
Formula:C121H193N33O30SMolecular weight:2,638.15 g/molFmoc-D-Asp(OtBu)-(Hmb)Gly-OH
CAS:Please enquire for more information about Fmoc-D-Asp(OtBu)-(Hmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C33H36N2O9Purity:Min. 95%Molecular weight:604.65 g/molMyelin Oligodendrocyte Glycoprotein (35-55) (mouse, rat) trifluoroacetate
CAS:Myelin oligodendrocyte glycoprotein (MOG) is a myelin protein found in the central nervous system. MOG is a ligand for CD200, which is an inhibitory receptor expressed by astrocytes. It has been shown that MOG can induce the proliferation and differentiation of primary cultures of rat astrocytes in vitro. MOG induces the production of reactive oxygen species in mitochondria and increases the expression of acid-binding protein, which are both important factors in the demyelination process. MOG has also been implicated as a potential factor in the development of multiple sclerosis. Further research into this protein may lead to new treatments or cures for disorders such as encephalomyelitis, nervous system diseases, or even cancer.
Formula:C118H177N35O29S•C2HO2F3Purity:Min. 95%Color and Shape:PowderMolecular weight:2,695.98 g/mol2A/2B Dengue Protease Substrate
Catalogue peptide; min. 95% purity
Formula:C39H68N16O11Molecular weight:937.08 g/molUru-TK II, Urechistachykinin II
Catalogue peptide; min. 95% purity
Formula:C44H66N14O10SMolecular weight:983.17 g/molLys-(Tyr8)-Bradykinin
Catalogue peptide; min. 95% purity
Formula:C56H85N17O13Molecular weight:1,204.41 g/mol[Tyr8,Nle11] Substance P
Catalogue peptide; min. 95% purity
Formula:C64H100N18O14Molecular weight:1,345.62 g/molBiotin-Neuromedin S (rat)
Catalogue peptide; min. 95% purity
Formula:C67H87N15O14Molecular weight:1,326.53 g/molInsulin Receptor (1142-1153)
Catalogue peptide; min. 95% purity
Formula:C72H107N19O24Molecular weight:1,622.77 g/molTGF α(34-43) (rat)
Catalogue peptide; min. 95% purity
Formula:C44H67N15O13S2Molecular weight:1,078.25 g/molBiotinyl-MCH (salmon)
Catalogue peptide; min. 95% purity
Formula:C99H153N29O26S5Molecular weight:2,325.82 g/molAc-a-CGRP (19-37) (human)
Catalogue peptide; min. 95% purity
Formula:C88H139N25O26Molecular weight:1,963.24 g/mol[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat
Catalogue peptide; min. 95% purity
Formula:C157H253N53O42Molecular weight:3,555.01 g/mol[Ile161]MAGE-A2 (157-166)
Catalogue peptide; min. 95% purity
Formula:C59H91N11O15Molecular weight:1,194.45 g/molKinase Domain of Insulin Receptor (5)
Catalogue peptide; min. 95% purity
Formula:C72H110N19O33Molecular weight:1,862.77 g/molAKT/PKB/Rac-Protein Kinase Substrate
Catalogue peptide; min. 95% purity
Formula:C74H114N28O20Molecular weight:1,715.91 g/molFluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Leu-Glu(OMe)-His-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C45H47FN6O14Purity:Min. 95%Molecular weight:914.89 g/molDisulfide biotin azide
CAS:Extraordinary strength of the streptavidin-biotin interaction allows for efficient capturing of even highly dilute targets; however, it makes recovery of proteins from affinity resins challenging. Conventional methods to elute biotinylated proteins from immobilized avidin include the following: (i) denaturation of streptavidin by boiling the resin in a denaturing buffer that may include high concentrations of chaotropic salts, (ii) trypsin digestion of proteins while they are bound to the resin, or (iii) elution of proteins with excess free biotin. These protocols can co-elute contaminant proteins by releasing nonspecifically bound proteins and/or naturally biotinylated proteins concurrently with labeled proteins. In addition, some of these methods can cause elution of high levels of resin-based peptides along with the proteins of interest, resulting in further sample contamination.
Disulfide Biotin Azide probe eliminates a major limitation of the streptavidin-biotin affinity purification. This reagent contains a biotin moiety linked to an azide moiety through a spacer arm containing a cleavable disulfide linker. Captured biomolecules can be efficiently released under mild conditions (50 mM dithiothreitol, 10 mM 2-mercaptoethanol or 1% sodium borohydride) and the small molecular fragment (188.25 Da) left on the labeled protein following cleavage. These features make the cleavable probe especially attractive for use in biomolecular labeling and proteomic studies.Formula:C27H48N8O7S3Purity:Min 95%Molecular weight:692.92 g/molFluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:Please enquire for more information about Fluorescein-6-carbonyl-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C43H47FN4O15Purity:Min. 95%Molecular weight:878.85 g/molRef: 3D-FF111109
Discontinued productCorticostatin, human
Catalogue peptide; min. 95% purity
Formula:C157H261N49O43S6Molecular weight:3,715.47 g/molBiotin-Obestatin (human)
Catalogue peptide; min. 95% purity
Formula:C126H190N34O35Molecular weight:2,773.19 g/molBiotin-Gastrin Releasing Peptide, human
Catalogue peptide; min. 95% purity
Formula:C140H218N40O33S3Molecular weight:3,085.74 g/mol[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C54H79N13O17Molecular weight:1,182.31 g/mol[Asn76] PTH (64-84), human
Catalogue peptide; min. 95% purity
Formula:C94H163N27O35Molecular weight:2,231.51 g/mol[Arg3] Substance P
Catalogue peptide; min. 95% purity
Formula:C63H98N20O13SMolecular weight:1,375.67 g/molAldosterone Secretion Inhibiting Factor (1-35) (bovine)
Catalogue peptide; min. 95% purity
Formula:C164H278N58O45S4Molecular weight:3,910.64 g/molHuman CMV Assemblin Protease Substrate (M-site)
Catalogue peptide; min. 95% purity
Formula:C52H96N20O16Molecular weight:1,257.47 g/molSarafotoxin S6d
Catalogue peptide; min. 95% purity
Formula:C112H167N27O34S5Molecular weight:2,596 g/molH-Asp-beta-Ala-OH
CAS:Please enquire for more information about H-Asp-beta-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C7H12N2O5Purity:Min. 90 Area-%Color and Shape:PowderMolecular weight:204.18 g/molRef: 3D-FA107994
Discontinued productAngiotensinogen (1-13)
Catalogue peptide; min. 95% purity
Formula:C79H116N22O17Molecular weight:1,645.9 g/molFmoc-Asp(OtBu)-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Asp(OtBu)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111724
Discontinued productZ-Asp-Gln-Met-Asp-AFC
CAS:Please enquire for more information about Z-Asp-Gln-Met-Asp-AFC including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C36H39F3N6O13SPurity:Min. 95%Molecular weight:852.79 g/molRef: 3D-FA110597
Discontinued productα-Conotoxin IMI
Catalogue peptide; min. 95% purity
Formula:C52H74N20O15S4Molecular weight:1,347.58 g/molH-SIYRYYGL-OH
Peptide H-SIYRYYGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
gp100 (178-187)
Catalogue peptide; min. 95% purity
Formula:C42H71N11O14S2Molecular weight:1,018.23 g/molAlpha-Dendrotoxin
CAS:Alpha-dendrotoxin is a type of neurotoxin that blocks the voltage-gated sodium channel, which provides the neuron with a steady supply of energy. This toxin is found in the venom of certain snakes and can cause paralysis and death. Alpha-dendrotoxin binds to site 1 on the voltage-gated sodium channel and prevents it from opening. It does this by binding to its receptor, which is located on the inside surface of the cell membrane, thus blocking other ions from entering or leaving the cell. The blockage of ions leads to neuronal function impairment, such as memory loss or muscle paralysis.
Formula:C305H472N98O84S6Purity:Min. 95 Area-%Color and Shape:PowderMolecular weight:7,048.02 g/molRef: 3D-FD108355
Discontinued productCJC-1295
CAS:CJC-1295 is a synthetic peptide, which is an analogue of growth hormone-releasing hormone (GHRH). It is synthesized through recombinant DNA technology, which allows for precise control over its sequence and length. This particular peptide is designed to bind to GHRH receptors in the pituitary gland. By activating these receptors, CJC-1295 stimulates the release of growth hormone (GH) into the bloodstream.The primary function of CJC-1295 is to influence the endocrine system, particularly enhancing the release of endogenous growth hormone. It achieves this by increasing the amplitude and frequency of GH pulses without affecting the natural negative feedback mechanisms that regulate GH production. This mode of action distinguishes CJC-1295 from other growth hormone therapies, as it promotes a more physiological pattern of hormone secretion.CJC-1295 is used in various scientific contexts, primarily in research focusing on growth hormone deficiencies, muscle wasting conditions, and certain metabolic disorders. Its ability to increase GH release also makes it a subject of interest in studies related to aging, tissue repair, and regeneration. The longer half-life of CJC-1295 compared to natural GHRH peptides further enhances its applications in research, allowing for more sustained and controlled experimentation.
Purity:Min. 95%Ref: 3D-FC138107
Discontinued productSALMF amide 2 (S2)
Catalogue peptide; min. 95% purity
Formula:C59H82N14O18Molecular weight:1,275.4 g/molSH2 Domain Ligand (4)
Catalogue peptide; min. 95% purity
Formula:C40H51N5O18P2Molecular weight:951.86 g/molAGRP (25-51)
Catalogue peptide; min. 95% purity
Formula:C130H221N37O35SMolecular weight:2,894.43 g/mol[Phe22] Big Endothelin-1 (19-37), human
Catalogue peptide; min. 95% purity
Formula:C104H152N26O26Molecular weight:2,182.53 g/molBiotin-Glucagon (1-29), bovine, human, porcine
Catalogue peptide; min. 95% purity
Formula:C163H239N45O51S2Molecular weight:3,709.03 g/molNeurotrophic Factor for Retinal Cholinergic Neurons
Catalogue peptide; min. 95% purity
Formula:C53H84N12O16Molecular weight:1,145.33 g/molbeta-Amyloid/A4 Protein Precursor (APP) (96-110), analog
Catalogue peptide; min. 95% purity
Formula:C81H128N32O19S2Molecular weight:1,918.25 g/molGastrin Releasing Peptide (1-16), human
Catalogue peptide; min. 95% purity
Formula:C74H121N17O20SMolecular weight:1,600.9 g/mol[Cys(Acm)20,31]-EGF (20-31)
Catalogue peptide; min. 95% purity
Formula:C63H98N16O23S3Molecular weight:1,543.77 g/molCaspase 1 Substrate 1m (ICE), fluorogenic
Catalogue peptide; min. 95% purity
Formula:C35H41N5O12Molecular weight:723.7 g/molP62 (417-429), M. leprae
Catalogue peptide; min. 95% purity
Formula:C65H116N16O17Molecular weight:1,393.75 g/molMyristoylated ADP-Ribosylation Factor 6, myr-ARF6 (2-13)
Catalogue peptide; min. 95% purity
Formula:C74H128N16O18Molecular weight:1,529.95 g/molTNF-α(10-36) (human)
Catalogue peptide; min. 95% purity
Formula:C131H211N43O38Molecular weight:2,996.41 g/molGRF (free acid) (human)
Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Formula:C215H357N71O67SMolecular weight:5,040.74 g/molNES Topoisomerase II alpha (1017-1028)
Catalogue peptide; min. 95% purity
Formula:C73H117N19O19Molecular weight:1,564.86 g/molα-Neo-Endorphin Analog
Catalogue peptide; min. 95% purity
Formula:C66H102N20O13Molecular weight:1,383.68 g/molbeta-Amyloid (1-11)
Catalogue peptide; min. 95% purity
Formula:C56H76N16O22Molecular weight:1,325.32 g/molCC Chemokine Receptor 3 Fragment II, amide
Catalogue peptide; min. 95% purity
Formula:C114H175N25O42S2Molecular weight:2,631.93 g/mol[Tyr1]-pTH (1-34) (rat)
Catalogue peptide; min. 95% purity
Formula:C186H295N55O49S2Molecular weight:4,149.86 g/molα-Bag Cell Peptide (1-8)
Catalogue peptide; min. 95% purity
Formula:C47H72N14O11Molecular weight:1,009.19 g/molPGC-1α (205-216), Proliferator-activated Receptor Coactivator-1 α (205-216)
Catalogue peptide; min. 95% purity
Formula:C65H109N17O19SMolecular weight:1,464.75 g/molBiotin-VIP (human, bovine, porcine, rat)
Catalogue peptide; min. 95% purity
Formula:C157H252N46O44S2Molecular weight:3,552.17 g/molMelanotan II, MT-Ⅱ
Catalogue peptide; min. 95% purity
Formula:C50H69N15O9Molecular weight:1,024.2 g/mol[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat
Catalogue peptide; min. 95% purity
Formula:C171H271N51O54S2Molecular weight:3,969.50 g/molTetanus toxin (TT) peptide
Catalogue peptide; min. 95% purity
Formula:C79H120N18O21Molecular weight:1,657.95 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
Catalogue peptide; min. 95% purity
Formula:C59H89N17O14Molecular weight:1,260.47 g/molFmoc-Phe-Wang resin (100-200 mesh)
Please enquire for more information about Fmoc-Phe-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Purity:Min. 95%Ref: 3D-FF111733
Discontinued productAmylin (human) trifluoroacetate salt
CAS:Amylin is a hormone that regulates the release of insulin from the pancreas. Amylin is a protein that consists of 39 amino acids, and in its natural form it is not soluble in water. The amyloid fibrils are insoluble aggregates of proteins that can be found in the brain tissue of patients with Alzheimer's disease. Amylin has been shown to have an entrapment efficiency greater than 96% by using polymeric particles with a diameter less than 50 microns. These particles are able to increase water solubility and nutrient metabolism, as well as improve evaporation rates. They also provide an increased surface area for absorption and pharmacological properties. Amylin has been shown to lower postprandial glycemia when used with insulin in type II diabetes mellitus patients, and may also be an anorectic agent.
Formula:C165H261N51O55S2Purity:Min. 95%Molecular weight:3,903.28 g/mol[Ile34]-beta-Amyloid (25-34)
Catalogue peptide; min. 95% purity
Formula:C40H72N12O13Molecular weight:929.09 g/molbeta-Lipotropin (1-10), porcine
Catalogue peptide; min. 95% purity
Formula:C42H66N10O15Molecular weight:951.05 g/molbeta-Amyloid (10-35)
Catalogue peptide; min. 95% purity
Formula:C133H204N34O37SMolecular weight:2,903.38 g/molAdrenomedullin (1-52), porcine
Catalogue peptide; min. 95% purity
Formula:C262H403N79O76S3Molecular weight:5,971.67 g/molSynaptobrevin-2 (75-78) (human, bovine, mouse, rat)
Catalogue peptide; min. 95% purity
Formula:C23H33N5O9Molecular weight:523.55 g/molVasoactive Intestinal Contractor [VIC]
Catalogue peptide; min. 95% purity
Formula:C116H161N27O32S4Molecular weight:2,573.99 g/molbeta-Amyloid (8-38)
Catalogue peptide; min. 95% purity
Formula:C147H227N39O43SMolecular weight:3,260.75 g/molNTB (Naltriben)
Catalogue peptide; min. 95% purity
Formula:C50H65N11O11S2Molecular weight:1,060.29 g/molbeta-Endorphin (27-31) (human)
Catalogue peptide; min. 95% purity
Formula:C28H45N7O9Molecular weight:623.71 g/molDynorphin A (2-13), porcine
Catalogue peptide; min. 95% purity
Formula:C66H117N23O13Molecular weight:1,440.81 g/mol[Ser25]-PKC (19-36) Substrate
Catalogue peptide; min. 95% purity
Formula:C93H159N35O25Molecular weight:2,167.52 g/molH-GILGFVFTL-OH
CAS:FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).
Formula:C49H75N9O11Molecular weight:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.
Formula:C40H62N12O9•(C2HF3O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:855 g/molH-ASCLYGQLPK-OH
Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C48H76N12O13SMolecular weight:1,079.27 g/molCerebellin trifluoroacetate
CAS:Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C69H113N23O23•(C2HF3O2)4Purity:Min. 95%Molecular weight:2,088.86 g/molRef: 3D-BC184180
Discontinued productCoibamide A
CAS:Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page
Formula:C65H110N10O16Purity:Min. 95%Molecular weight:1,287.65 g/molRef: 3D-BC183236
Discontinued product
![[D-Phe7] a-MSH, amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00051.webp&w=3840&q=75)
![[Tyr8,Nle11] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00677.webp&w=3840&q=75)
![[Glu2]-TRH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00171.webp&w=3840&q=75)
![[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00488.webp&w=3840&q=75)
![[Ile161]MAGE-A2 (157-166)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00894.webp&w=3840&q=75)
![[Tyr27]-a-CGRP (27-37) (canine, mouse, rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00929.webp&w=3840&q=75)
![[Asn76] PTH (64-84), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00372.webp&w=3840&q=75)
![[Arg3] Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00678.webp&w=3840&q=75)
![[Phe22] Big Endothelin-1 (19-37), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00505.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Tyr0]-α-CGRP, [Tyr0]-α-CGRP, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00921.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Ile34]-beta-Amyloid (25-34)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00451.webp&w=3840&q=75)
![Vasoactive Intestinal Contractor [VIC]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00288.webp&w=3840&q=75)
![[Ser25]-PKC (19-36) Substrate](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00658.webp&w=3840&q=75)
