
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30315 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH
Peptide H-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:1,521.76 g/molH-LTGISDPVTVK^-OH
Peptide H-LTGISDPVTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLQESNVLYQHNLR^-OH
Peptide H-FLQESNVLYQHNLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Met-Ile-Val
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C16H31N3O4S1Molecular weight:361.5 g/molH-DYWSTVK^-OH
<p>Peptide H-DYWSTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IFGVTTLDIVR^-OH
<p>Peptide H-IFGVTTLDIVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ICLDLQAPLYK^-OH
Peptide H-ICLDLQAPLYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.proFIX18
<p>Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C95H157N31O27Molecular weight:2,165.5 g/molH-WAAVVVPSGEEQR^-OH
Peptide H-WAAVVVPSGEEQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTAVTRPVETHELIR^-OH
<p>Peptide H-TTAVTRPVETHELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DSGSSLIR^-OH
<p>Peptide H-DSGSSLIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 131 (YRIFAELEGVWQPAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,750 g/molH-TYPVPFQR^-OH
<p>Peptide H-TYPVPFQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Leu-Asp-OH
CAS:H-Leu-Asp-OH is a phenolic compound that is synthesized by the esterification of L-leucine and L-aspartic acid. The solubility of H-Leu-Asp-OH in organic solvents, such as dichloromethane and ethanol, is higher than in water. This product can be used as a solvent for other substances and as a boosting agent for other products during clinical trials. It has been shown to have health effects on humans, but more research is needed to determine any possible side effects or long term health problems.Formula:C10H18N2O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:246.26 g/molH-SDGPVK^V-OH
<p>Peptide H-SDGPVK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,680.8 g/molH-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Human Histatin 2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C158H211N45O44Molecular weight:3,444.6 g/molH-TTEPVSELLK^-OH
<p>Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Z-Gly-Gly-Arg-AMC·HCl
CAS:Z-Gly-Gly-Arg-AMC·HCl is a proteolytic enzyme that cleaves proteins at the carboxyl side of the amino acid arginine. It has been shown to have potential as a drug target and has been found to be active against carcinoma cell lines, but not normal cells. Z-Gly-Gly-Arg-AMC·HCl is activated by light and can be inhibited by natural compounds such as 2-aminoethoxydiphenyl borate. In addition, it specifically cleaves proteins at the carboxyl side of arginine residues, which makes it useful for studying protein degradation mechanisms in living cells and tissues.Formula:C28H33N7O7·HClPurity:Min. 98%Color and Shape:White PowderMolecular weight:616.07 g/molH-GVYYPDK^-OH
Peptide H-GVYYPDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MDSRELALASLMC-NH2 PAB-405-1336E
Peptide H-MDSRELALASLMC-NH2 PAB-405-1336E is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Glu1] Fibrinopeptide B, human
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C66H95N19O26Molecular weight:1,570.6 g/molH-V^IFDANAPV^AV^R^-OH
Peptide H-V^IFDANAPV^AV^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.[Glu4]-Oxytocin
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C43H65N11O13S2Molecular weight:1,008.17 g/molH-HSSYWYAFNNKT-NH2
Peptide H-HSSYWYAFNNKT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSSSFEVR^-OH
<p>Peptide H-TSSSFEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AITIFQER^-OH
<p>Peptide H-AITIFQER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FIDK^VRF-NH2
<p>Peptide H-FIDK^VRF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 29
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,630.1 g/molH-Orn-Orn-Orn-OH acetate salt
CAS:H-Orn-Orn-Orn-OH acetate salt is a chemical compound with the molecular formula C10H14O2. It is used as a building block in organic chemistry, often as an intermediate for the synthesis of other compounds, or as a reagent.Formula:C15H32N6O4Purity:Min. 95%Color and Shape:PowderMolecular weight:360.45 g/molLCBiot-RVTHHAFLGAHRTVG-OH
Peptide LCBiot-RVTHHAFLGAHRTVG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TVLAVFGK^-OH
<p>Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Urocortin III (human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C185H307N53O50S2Molecular weight:4,137.93 g/molAc-LVLRLRGG-CHO
<p>Peptide Ac-LVLRLRGG-CHO is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CTETVKAEKMETD-OH
Peptide Ac-CTETVKAEKMETD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.2-[[2-[[2-[[2-[[2-[[5-Amino-2-[[5-amino-2-[[1-[6-amino-2-[[1-[2-amino-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]am ino]hexanoyl]pyrrolidine-2-carbonyl]amino]-5-oxopentanoyl]amino]-5-oxopentanoyl]amino]-3-phenylpropanoyl]amino]-3-phenylpr
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C63H98N18O13SMolecular weight:1,348.65 g/molH3(1-14)K4me3
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-DPAPRRGEPHVTRRTPDYFL-OMe
Peptide H-DPAPRRGEPHVTRRTPDYFL-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Boc-Gly-Lys-Arg-AMC·HCl
CAS:<p>Boc-Gly-Lys-Arg-AMC·HCl is a versatile building block for the synthesis of diverse and complex compounds. It is a high quality, useful intermediate that can be used as a reaction component or scaffold to synthesize more complex molecules. Boc-Gly-Lys-Arg-AMC·HCl has been shown to be useful in the synthesis of pharmaceuticals, agrochemicals, and other specialized chemicals.</p>Formula:C29H44N8O7·HClPurity:Min. 97 Area-%Color and Shape:PowderMolecular weight:653.17 g/molH-GVSGLNAGNAASIPSK^-OH
Peptide H-GVSGLNAGNAASIPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SVLGQL^GITK-OH
<p>Peptide H-SVLGQL^GITK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DDQSIQK^-OH
<p>Peptide H-DDQSIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VFSLQWGEVK^-OH
<p>Peptide H-VFSLQWGEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HLA-A*02:01 Human RNA-dependent helicase YLLPAIVHI
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>CMVpp65 - 134 (PAAQPKRRRHRQDAL)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,800.1 g/molMastoparan A
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C79H138N20O16Molecular weight:1,624 g/molHIV - 1 MN ENV - 120
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,987.3 g/molH-SPAQILQWQVLSNTVPAK^-OH
Peptide H-SPAQILQWQVLSNTVPAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GAL^^QNIIPASTGAAK-OH
<p>Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQGLPQEVLNENLLR^-OH
<p>Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>N-Formyl-Met-Leu-Phe
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C21H31N3O5SMolecular weight:437.6 g/molH-DRVYI^HPFHL-OH
<p>Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SILKV-NH2
<p>Peptide H-SILKV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EL^AGIGILTV-OH
<p>Peptide H-EL^AGIGILTV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAPEEHPTLLTEAPL^NPK-OH
Peptide H-VAPEEHPTLLTEAPL^NPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TYLPAV^DEK-OH
Peptide H-TYLPAV^DEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AVLTIDK^K^-OH
Peptide H-AVLTIDK^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SH-pNA
<p>Peptide Ac-SH-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 73
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,861.1 g/molH-YVEQQYGQPSSK^-OH
<p>Peptide H-YVEQQYGQPSSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>ECT2
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LTYTAEVSVPK^-OH
<p>Peptide H-LTYTAEVSVPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpy-NH2
<p>Peptide Ac-Rpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GSARAEVHLRKS-NH2
Peptide Ac-GSARAEVHLRKS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKESPVIAKYMPTEAVRVT-OH
<p>Peptide Ac-CKESPVIAKYMPTEAVRVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-A^^^PG-OH
<p>Peptide H-A^^^PG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQSLPTHDPSPL^QR-OH
<p>Peptide H-GLQSLPTHDPSPL^QR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CDDYYYGFGCNKFGRPRDD-NH2
<p>Peptide H-CDDYYYGFGCNKFGRPRDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VEITYTPSDGTQK^-OH
<p>Peptide H-VEITYTPSDGTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SEPEA-OH
<p>Peptide H-SEPEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Color and Shape:PowderSubstance P (5-11)/Hepta-Substance P
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H60N10O9SMolecular weight:869.06 g/molHIV - 1 MN ENV - 62
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,638.9 g/molAc-VPAPRYTVELAC-NH2
<p>Peptide Ac-VPAPRYTVELAC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ERPPPVPNPDYEPIR^-OH
Peptide H-ERPPPVPNPDYEPIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DAAQK^-OH
<p>Peptide H-DAAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TGIVSGFGR^-OH
Peptide H-TGIVSGFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FSGEYIPTV^-OH
<p>Peptide H-FSGEYIPTV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-CVPQTPL^HTSR-OH
<p>Peptide H-CVPQTPL^HTSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Biot-SFNDTLDFD-OH
<p>Peptide Biot-SFNDTLDFD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TAMRA-QKRPSQRSKYL-OH
<p>Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LPDATPTELAK^-OH
<p>Peptide H-LPDATPTELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>TRAP-14 amide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C81H119N21O22Molecular weight:1,738.96 g/molH-NSSVSGIFTFQK^-OH
<p>Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-FHENWPS-OH
<p>Peptide LCBiot-FHENWPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-RDKVESQVESAPKEC-NH2
<p>Peptide Ac-RDKVESQVESAPKEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HP^DASVNFSEFSK-OH
Peptide H-HP^DASVNFSEFSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-R^PPGFSPFR-OH
Peptide H-R^PPGFSPFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FESSAAKLKRKYWWK^NLK^-OH
<p>Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GIIFNNGPTWK^-OH
<p>Peptide H-GIIFNNGPTWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GQPLSPEK^-OH
<p>Peptide H-GQPLSPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KSAPATGGVKKPHR^-OH
<p>Peptide H-KSAPATGGVKKPHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Hemopexin [069-079]
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-LVLLNAIYLSAK^-OH
<p>Peptide H-LVLLNAIYLSAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 127 (GQNLKYQEFFWDAND)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,875 g/molH-THLAPYSDEL^R-OH
<p>Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-REDEDEIEW-OH
<p>Peptide Fluor-REDEDEIEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
