Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30315 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2
<p>Peptide LCBiot-QDGNEEMGGITQTPYKVSISGTTVILT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GSLVEGGIGGTEAR^-OH
<p>Peptide H-GSLVEGGIGGTEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVVGAVGVGK^-OH
Peptide H-VVVGAVGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 78
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,720 g/molH-YNGIITDTI^K-OH
Peptide H-YNGIITDTI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALQDQLVLVAA^K^-OH
<p>Peptide H-ALQDQLVLVAA^K^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CCLLMPPPPPLFPPPFF-NH2
<p>Peptide Ac-CCLLMPPPPPLFPPPFF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TYFAVLM-NH2
<p>Peptide H-TYFAVLM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TFERRN-NH2
<p>Peptide H-TFERRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 95
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,650 g/molAc-NQSYQYGPSSAGNGAGC-NH2
<p>Peptide Ac-NQSYQYGPSSAGNGAGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-SSGPTIEEVD-OH
<p>Peptide Ac-SSGPTIEEVD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AAAHVVEGAAGYAGHK^-OH
Peptide H-AAAHVVEGAAGYAGHK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMQL^G-OH
<p>Peptide H-DMQL^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-YGGFLRRIRPKLK-OH
<p>Peptide LCBiot-YGGFLRRIRPKLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VVDVEEQQLEESGPHDLTETSYLPR^-OH
<p>Peptide H-VVDVEEQQLEESGPHDLTETSYLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 12
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,556.8 g/molH2N-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-COOH
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C31H55N11O9S1Molecular weight:757.9 g/molH-CLAVEEVSL^-OH
Peptide H-CLAVEEVSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GFYPSDIAVEWESNGQPENNYK-OH
<p>Peptide H-GFYPSDIAVEWESNGQPENNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Tic-[Pen-Phe-D-Trp-Orn-Tyr-Cys]-Val-OH
<p>H-Tic-[Pen-Phe-D-Trp-Orn-Tyr-Cys]-Val-OH is a peptide that inhibits the activity of Urotensin II. It is a potent antagonist of Urotensin II and has been shown to inhibit the binding of Urotensin II to its receptor. H-Tic-[Pen-Phe-D-Trp-Orn-Tyr-Cys]-Val-OH also has been shown to inhibit the binding of urotensin II to its receptor. H-Tic-[Pen-Phe-D-Trp--]Val--OH may be used in research as a tool for studying how peptides affect the body's hormone system.</p>Formula:C57H70N10O10SPurity:Min. 95%Molecular weight:1,119.38 g/molH-VPEPCHPK^-OH
<p>Peptide H-VPEPCHPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Acetyl-TGF-beta 2-LAPbeta (259- 269)
<p>Latent TGF-β is a non-lysosomal glycoprotein with mannose 6-phosphate (Man-6-P) residues on its N-glycans. When it is released, latent TGF-β is bound to its latency-associated peptide (LAP), it must then be activated and released from LAP before it can bind to its cell surface-localised Man-6-P receptors and exert its biological activity. Activation can occur by various mechanisms in vivo, including those governed by integrins and thrombospondin. Mannose phosphorylation has also been implicated in this activation process. Man-6-P has been proposed as an anti-scarring therapy due to its ability to directly block the activation of latent TGF-β.</p>Color and Shape:PowderMolecular weight:1,267.6 g/molLCBiot-TFCGTPEYLAPEVLEDNDYGR-OH
Peptide LCBiot-TFCGTPEYLAPEVLEDNDYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHFANLK^-OH
<p>Peptide H-SHFANLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PAR-2 (1-6) (mouse, rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C29H56N10O7Molecular weight:656.83 g/molPal-KVK-OH
Peptide Pal-KVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CONSENSUS B Tat - 15
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,681.8 g/molH-GG^^G-OH
Peptide H-GG^^G-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2
<p>Peptide Ac-KKKKKRFSFKKSFKLSGFSFKKNKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Adrenomedullin 2 (Human, 1-7) Antiserum
<p>Adrenomedullin 2 (Human, 1-7) Antiserum is a research tool that is an antibody. This antibody is used to detect the presence of adrenomedullin 2 in human serum and tissue. It has been shown to inhibit ion channels, activate receptors, and bind to cell surface proteins. This antibody can also be used as a ligand for receptor binding studies or in assays for protein interactions.</p>Purity:Min. 95%H-YGGFLRRIR^PKLKWDNQ-OH
<p>Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FSLTTLR^-OH
Peptide H-FSLTTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELL^ETGDNR^-OH
<p>Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 123 (AGILARNLVPMVATV)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,524.9 g/molProsaptide TX14(A)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C69H110N16O26Molecular weight:1,579.72 g/molH-NINNN-NHMe
Peptide H-NINNN-NHMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-RP^QQPYPQPQPQY-OH
<p>Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SV^EGSCGF-OH
<p>Peptide H-SV^EGSCGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH
<p>Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SDAPIGK^-OH
<p>Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NSSFNPAALSR^-OH
Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASLFSFK^-OH
<p>Peptide H-ASLFSFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FESSAAKLKRKYWWKNLK^-OH
<p>Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2
<p>Peptide Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-PLL-OH
<p>Peptide Ac-PLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLQAQGYGVR^-OH
Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PAR-3 (1-6) amide (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C29H46N10O7Molecular weight:646.75 g/molH-GLKEIFKAGLGSLVKGIAAHVAS-NH2
<p>Peptide H-GLKEIFKAGLGSLVKGIAAHVAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GTFIIDPGGVIR^-OH
<p>Peptide H-GTFIIDPGGVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EKAHDGGR^YYRA-OH
<p>Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-DRVYIHPF-OH
<p>Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HQFLLTGDTQGR^-OH
<p>Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEGLQEALLK^^-OH
<p>Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Phosphatidylcholine-sterol acyltransferase [086-099]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMet-Enkephalin
<p>Peptide Met-Enkephalin is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C27H35N5O7SMolecular weight:573.67 g/molH-Pro-Asp-OH
CAS:H-Pro-Asp-OH is a conjugate of the amino acid proline and aspartic acid. H-Pro-Asp-OH is synthesized in the liver, where it can be found in the extracellular environment. This drug has been shown to be effective against hyperproliferative disorders and cancer. H-Pro-Asp-OH binds to the surface of cells, which inhibits the growth rate of cancer cells by inhibiting the synthesis of DNA, RNA, and proteins. The uptake of this drug by cells is increased when dietary protein levels are low. H-Pro-Asp-OH has also been shown to inhibit cell proliferation in humans and pigs.Formula:C9H14N2O5Purity:Min. 95%Color and Shape:White PowderMolecular weight:230.22 g/molAc-TTWI-NH2
<p>Peptide Ac-TTWI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myr-RWKFGGFKWR-OH
<p>Peptide Myr-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ENQLEVLEVSWLHGLK^-OH
Peptide H-ENQLEVLEVSWLHGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ISQAVHAAHAEINEAGR-cysteamide
Peptide H-ISQAVHAAHAEINEAGR-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DGFFGNPR^-OH
<p>Peptide H-DGFFGNPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IIPGGIYNADLNDEWVQR^-OH
Peptide H-IIPGGIYNADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SEEFLIAGK^-OH
Peptide H-SEEFLIAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-CKGGAKL-OH
<p>Peptide Ac-CKGGAKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VAIDAGYR^-OH
<p>Peptide H-VAIDAGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SASFNTDPYVR^-OH
<p>Peptide H-SASFNTDPYVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-70
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,703.9 g/molH-YLQPR^TFLL-OH
Peptide H-YLQPR^TFLL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTGMAFR^-OH
Peptide H-LTGMAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GLYASKLS-NH2
Peptide H-GLYASKLS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 80
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,748 g/molH-LPGTYVVVLK^-OH
<p>Peptide H-LPGTYVVVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 52 (VCSMENTRATKMQVI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,711.1 g/molH-VGTQFIR^-OH
<p>Peptide H-VGTQFIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-RRRR-OH
<p>Peptide 5Fam-RRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Dabcyl-AETFYVDG-Edans
<p>Peptide Dabcyl-AETFYVDG-Edans is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuromedin B (porcine)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C52H73N15O12SMolecular weight:1,132.3 g/molH-ALEKDY-NH2
<p>Peptide H-ALEKDY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IPLENLQIIR^-OH
<p>Peptide H-IPLENLQIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Rpw-NH2
<p>Peptide Ac-Rpw-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SIINFEKL^-OH
CAS:<p>Peptide H-SIINFEKL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Molecular weight:970 g/molH-ENLQFSAALR^-OH
<p>Peptide H-ENLQFSAALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>αs2-Casein peptide fragment
Peptide H-NAVPITPTLNR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IL^DTAGL^EEY-OH
<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5Fam-MEVGWYRSPFSRVVHLYRNGK-OH
<p>Peptide 5Fam-MEVGWYRSPFSRVVHLYRNGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GV^YDGEEHSV^-OH
Peptide H-GV^YDGEEHSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C42H74N10O12SMolecular weight:943.18 g/molDynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C99H155N31O23Molecular weight:2,147.5 g/molH-IGEGTYGVVYK^-OH
<p>Peptide H-IGEGTYGVVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH
<p>Peptide Fluor-GSRAHSSHLKSKKGQSTSRHKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CSWYNGHRPEPGLG-NH2
<p>Peptide Ac-CSWYNGHRPEPGLG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Boc-Dap-OtBu hydrochloride salt
CAS:Boc-Dap-OtBu hydrochloride salt is a chemical that is synthesized by anhydride and trifluoroacetic acid. It can be used in the laboratory for protein visualization, as well as to detect proteins using LC-MS. The presence of trifluoroacetic acid makes the Boc-Dap-OtBu hydrochloride salt fluorescent, which makes it possible to visualize the reaction products under UV light. This chemical is often used in fluorescence spectrometry to identify amino acids and other compounds.Formula:C12H24N2O4Purity:Min. 95%Color and Shape:PowderMolecular weight:260.33 g/molBiot-FKNIVTPRTPPPSQG-OH
Peptide Biot-FKNIVTPRTPPPSQG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.ZnT-8 93-101 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-QTALVELLK^-OH
<p>Peptide H-QTALVELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQEVAGSLIFR^-OH
<p>Peptide H-IQEVAGSLIFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-46
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,624.8 g/molTertiapin-Q trifluoroacetate salt
CAS:A peptide found in honey bee venom; Potassium channel inhibitorFormula:C106H175N35O24S4Purity:Min. 95%Molecular weight:2,452.01 g/molH-GFGFK^-OH
Peptide H-GFGFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
![H-Tic-[Pen-Phe-D-Trp-Orn-Tyr-Cys]-Val-OH](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPUT-3928-PI.webp&w=3840&q=75)
![Phosphatidylcholine-sterol acyltransferase [086-099]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FPP50833.webp&w=3840&q=75)
