
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30315 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
H-EDLTEIR^-OH
<p>Peptide H-EDLTEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KAVYNLATC-OH
<p>Peptide H-KAVYNLATC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C43H69N11O12SColor and Shape:PowderMolecular weight:982.15 g/mol[Des-Arg9]-Bradykinin
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C44H61N11O10Molecular weight:904.04 g/molH-VHITSLLPTPEDNLEIVLHR^-OH
<p>Peptide H-VHITSLLPTPEDNLEIVLHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GLGDVDQLVK^-OH
<p>Peptide H-GLGDVDQLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CAS-NH2
<p>Peptide Ac-CAS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Qpy-NH2
<p>Peptide Ac-Qpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 9
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,697.9 g/molH-AAAASAISVARTLLV^FE-OH
Peptide H-AAAASAISVARTLLV^FE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MVLASTTAK^-OH
<p>Peptide H-MVLASTTAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ASLEDLGWADWVLSPR^-OH
<p>Peptide H-ASLEDLGWADWVLSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLGASVLGL^-OH
<p>Peptide H-LLGASVLGL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ALGISPFHEHAEVVFTANDSGPR^-OH
<p>Peptide H-ALGISPFHEHAEVVFTANDSGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Bradykinin (2-9)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C44H61N11O10Molecular weight:904.04 g/molBoc-LFGGY-OH
<p>Peptide Boc-LFGGY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HLVDEPQNLIK^-OH
Peptide H-HLVDEPQNLIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLDPER^-OH
<p>Peptide H-TLDPER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HIV - 1 MN ENV - 197
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,976.3 g/molMastoparan A
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C79H138N20O16Molecular weight:1,624 g/molCrotonic-HFRRHL-OH
<p>Peptide Crotonic-HFRRHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELRRKMMYM-NH2
<p>Peptide H-ELRRKMMYM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Aoa-THRPPMWSPVWP-NH2
<p>Peptide Aoa-THRPPMWSPVWP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>SIVmac239 - 82
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,569.9 g/molH-DDQSIQK^-OH
<p>Peptide H-DDQSIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH
Peptide H-TSESGELHGLTTEEEF^VEG^I^YKVEIDTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DALSSVQESQV^AQQAR-OH
Peptide H-DALSSVQESQV^AQQAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-KYQAVTTTL-OH
<p>Peptide H-KYQAVTTTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DPAPRRGEPHVTRRTPDYFL-OMe
Peptide H-DPAPRRGEPHVTRRTPDYFL-OMe is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Hemoglobin β chain [001-008]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C42H69N11O14Molecular weight:952 g/molH-AGEVQEPELR^-OH
<p>Peptide H-AGEVQEPELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATEIIEPSK^-OH
Peptide H-ATEIIEPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VLSALQAVQGLLVAQGR^-OH
<p>Peptide H-VLSALQAVQGLLVAQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Lys-Leu-Val-Val-Val-Gly-Ala-Gly-Gly-Val
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C41H75N11O11Molecular weight:898.1 g/molLCBiot-HASTNMGLEAIIRKALMGKYDQW-OH
Peptide LCBiot-HASTNMGLEAIIRKALMGKYDQW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LNFGDDIPSALR^-OH
<p>Peptide H-LNFGDDIPSALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SHLTTGGDVR^-OH
<p>Peptide H-SHLTTGGDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQGTLPVEAR^-OH
Peptide H-LQGTLPVEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMLDL^QPET-OH
<p>Peptide H-YMLDL^QPET-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IEIYPTSLTK^-OH
Peptide H-IEIYPTSLTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 37
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,731.1 g/molHXB2 gag NO-29
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,554.6 g/molH-L^VAASQAALG-OH
<p>Peptide H-L^VAASQAALG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Synthetic SAA1 (1-76) protein (Human)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:8,575.21 g/molH-TTEPVSELLK^-OH
<p>Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>PB1(703 - 711), Influenza
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C45H75N15O13Molecular weight:1,034.19 g/molBiot-LMKNMDPLNDNV-NH2
<p>Peptide Biot-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Pr-EIR-OH
<p>Peptide Pr-EIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDEETGEFL-NH2
<p>Peptide H-LDEETGEFL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-Ala-Ala-Ala-NH2
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C11H20O4N4Molecular weight:272.3 g/molSIVmac239 - 12
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,618.8 g/molH-TYPVPFQR^-OH
<p>Peptide H-TYPVPFQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LSLVPDSEQGEAILPR^-OH
<p>Peptide H-LSLVPDSEQGEAILPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 43 (TRQQNQWKEPDVYYT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,956.1 g/mol5TAMRA-QEPEPPEPFEYIDD-OH
Peptide 5TAMRA-QEPEPPEPFEYIDD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AzidoPEG4-WNPDDYGGVK-NH2
Peptide AzidoPEG4-WNPDDYGGVK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILTVDELLAIR^-OH
<p>Peptide H-GILTVDELLAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LNALKPDNR^-OH
<p>Peptide H-LNALKPDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-F^F^-OH
<p>Peptide H-F^F^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFTSSTSYNR^-OH
Peptide H-QFTSSTSYNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLLPGELAK^-OH
<p>Peptide H-LLLPGELAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGADMEDV^R-OH
<p>Peptide H-LGADMEDV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-IQIIPK^-OH
<p>Peptide H-IQIIPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DYWSTVK^-OH
<p>Peptide H-DYWSTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-I^DAL^NENK-OH
<p>Peptide H-I^DAL^NENK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TEGDGVYTLNDK^-OH
<p>Peptide H-TEGDGVYTLNDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>CMVpp65 - 62 (TLGSDVEEDLTMTRN)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,680.8 g/molHLA-A*24:02 Human LMP2 PYLFWLAAI
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,093.3 g/molH-ATNYNAGDR^-OH
<p>Peptide H-ATNYNAGDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH
Peptide H-His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:1,521.76 g/molH-SLEGSDDAVLLQR^-OH
Peptide H-SLEGSDDAVLLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-FRHD-OH
<p>Peptide pE-FRHD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-YEALLLGGLPQEGLAR^-OH
<p>Peptide H-YEALLLGGLPQEGLAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TPDVSSAL^DK-OH
<p>Peptide H-TPDVSSAL^DK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TSLAVLGK^-OH
<p>Peptide H-TSLAVLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-TYRPPQPAWMFGDPHIC-OH
Peptide Ac-TYRPPQPAWMFGDPHIC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-AMC hydrochloride
CAS:H-Arg-AMC hydrochloride is a denaturing agent that is used to prevent the proteolytic degradation of proteins in muscle and other tissues. It has been shown to inhibit the activity of lipase, myofibrillar, and endoplasmic enzymes. H-Arg-AMC hydrochloride also has cancer preventive effects by inhibiting the growth of tumor cells. H-Arg-AMC hydrochloride has been shown to have high values in notochord markers, supplementing cytosolic markers, and endogenous markers.Formula:C16H21N5O3·xHClPurity:Min. 95%Color and Shape:White PowderMolecular weight:331.37 g/molH-IADFGLARLIEDNEYTARQGAK^-OH
Peptide H-IADFGLARLIEDNEYTARQGAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 31 (LNIPSINVHHYPSAA)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,632.8 g/molH-RQDNEILIFWSK^-OH
Peptide H-RQDNEILIFWSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NAVPITPTLNR^-OH
<p>Peptide H-NAVPITPTLNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-YGGFLRRQFKVVT-OH
Peptide Ac-YGGFLRRQFKVVT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-V^LSGEDKSNIK-OH
<p>Peptide H-V^LSGEDKSNIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>α-Neo-Endorphin, porcine
Peptide α-Neo-Endorphin, porcine is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C60H89N15O13Molecular weight:1,228.47 g/molH-FVQENYLEY^-OH
Peptide H-FVQENYLEY^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VTSIQDWV^QK^-OH
<p>Peptide H-VTSIQDWV^QK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-VTSAPDTRPAPGSTAPPAHG-OH
<p>Peptide LCBiot-VTSAPDTRPAPGSTAPPAHG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-VNSQSLSPYLFR^-OH
<p>Peptide H-VNSQSLSPYLFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EL^SEALGQIFDSQR^-OH
<p>Peptide H-EL^SEALGQIFDSQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-SQNPVQP-NH2
Peptide LCBiot-SQNPVQP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ASPAFLASQNTK^-OH
Peptide H-ASPAFLASQNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.PASD1 167-175 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-VVVGAGGVGK^-OH
Peptide H-VVVGAGGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHALQLNNR^-OH
<p>Peptide H-SHALQLNNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-QFPILLDFK^-OH
<p>Peptide H-QFPILLDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>[Tyr4]-Bombesin
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C74H108N24O19SMolecular weight:1,669.9 g/molHXB2 gag NO-107
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,778 g/molCys29, VIP, human
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-SLVMSGPYELK^-OH
<p>Peptide H-SLVMSGPYELK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
