Peptides

<p>Peptide Ac-RRCPLYISYDPVCRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-LEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-ETIEIETQVPEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GHIISLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-RQARRNRRRRWRC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-GATQQILDEAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide LCBiot-GDGNSVLKPGNW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SV^EGSCGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-YAFGYPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EVTNFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-FRHDS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GLQAQGYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DPGSAAPYLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-RV^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LDSIICVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SGATGVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-VLDGLDVLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SVINDPVYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CSHRKSLPKAD-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-K^LVVVGAVGV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-SYSMEHF^RWGKPV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-CGFECVRQCPERC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-STSGGTAALGCL^VK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-ISQAVHAAHAEINEAGR-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IIPGGIYNADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>H-Pro-Arg-bNA·HCl is a reagent, complex compound and useful intermediate with the CAS number 201998-83-6. It is a fine chemical that is used as a useful scaffold or building block for the synthesis of other chemicals. This product can be used in research and as a versatile building block for reactions.</p>

<p>Peptide H-KKVVFKVKFK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Decanoyl-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-FQSGIGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide H-SNLELLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Peptide H-LLVVYPWTQR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Fmoc-Pro-Rink-Amide MBHA Resin is an amino acid resin that is used for the synthesis of peptides and proteins. It has a high purity and can be used as a research tool in the fields of pharmacology, protein interactions, receptor binding, ion channels, ligand binding, antibody production, or cell biology. Fmoc-Pro-Rink-Amide MBHA Resin is also an inhibitor of cyclic nucleotide phosphodiesterases. The chemical name for this product is 4-(2(2-(2-(3-(4-(dimethylamino)phenyl)amido)-6(1H)-pyridinyl)ethoxy)ethoxy)benzoic acid methyl ester hydrochloride.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-IPLENLQIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GPSVFPLAPSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-LEAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-HLEDVFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-DPLPDPLLDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Ac-GQVGRQLAIIGDDINR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Peptide Ac-CVYVRSAIQLGNYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-RLLVP^TQFV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-VAAEDWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

H-Arg-Arg-AMC hydrochloride salt is a proteolytic inhibitor that binds to the active site of aminopeptidases and prevents their proteolytic activity. This inhibition leads to increased muscle mass in juveniles, as well as higher concentrations of magnesium ions in sarcoplasmic and myofibrillar proteins. H-Arg-Arg-AMC hydrochloride salt also has an inhibitory effect on ion exchange and chloride transport in muscle cells. The biochemical effects of this drug are due to its ability to inhibit the aminopeptidase enzymes, which play a role in the metabolism of amino acids.

Peptide H-SKIGSTENLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-R^GFFYTPKT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Ac-Asp-Glu-Val-Asp-AMC ammonium salt is a small molecule that is used as a tool to study apoptosis in vitro. Ac-Asp-Glu-Val-Asp-AMC ammonium salt induces apoptosis by blocking the mitochondrial membrane potential and inducing the release of cytochrome c from mitochondria into the cytoplasm. This drug also induces activation of caspase 3, which initiates the cascade of events leading to cell death. Ac-Asp-Glu-Val-Asp-AMC ammonium salt has been shown to have an antiangiogenic effect on hl60 cells. This effect may be due to its ability to inhibit expression of survivin, a protein that protects cells from apoptosis. The efficacy of this drug in an experimental model has been shown to be dependent on toll like receptor (TLR) signaling pathways and mitochondrial function.br>

Peptide H-FTISADTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-His-Ala-OH is a peptide hormone that is derived from the amino acid histidine. It has been shown to be a potent inhibitor of tumor growth in human breast cancer tissue and human serum. H-His-Ala-OH inhibits the release of peptide hormones, such as insulin and glucagon. This compound also has anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins. H-His-Ala-OH interacts with collagen via a number of mechanisms, including inhibition of proteolytic enzymes and binding with collagenase. H-His-Ala-OH also binds to casein, which is found in milk. The interaction between casein and H-His-Ala-OH leads to an increase in systolic blood pressure in rats and mice.

Peptide H-YQAIF^DNTTSLTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

H-Val-Asp-OH is a nucleotide that is an intermediate in the synthesis of tRNA. It is synthesized from H-Valine, Aspartic acid and Oxygen by the enzyme aminoacyl synthetase. The ribonucleotide H-Val-Asp-OH is used to elucidate the role of RNA polymerase in vitro transcription. It also plays a role in protein synthesis as it is an aminoacylated dipeptide with a 3’ terminal adenylate residue. This nucleotide can be incorporated into tRNA molecules by the enzyme aminoacyl tRNA synthetase.

Peptide H-GPEQTQGNFGDQELIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide H-HGEGTFTSDLSKQMEEEAVRL^FIEWL^KNGGPSSGAPPPS-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-GDVFVIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

FLAG peptide

<p>Peptide H-FTDEYQLYEDIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

Fragment of the signal peptide from endogenous HLA Class I molecules which is also found in viral glycoproteins, for example human Cytomegalovirus (hCMV) protein UL40.  When presented on a cell surface via HLA-E molecules, the HLA-peptide complex binds NKG2A receptors on Natural Killer (NK) cells and some CD8⁺ cytotoxic T cells to reduce their cytotoxic activity. Blocking this interaction is an attractive opportunity for immune checkpoint (IC) approach therapies. This is relevant in both cancer therapies, and viral infections, where endogenous HLA Class I peptide presentation is exploited to escape immune attack.Peptide H-VMAPRTLL^-OH is a heavy-labeled version of PP45242, and is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-APAMFNIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide Ac-CGRGQSQRPSPDT-OH PAB-405-1338G is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide DOTA-GRRRRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-RGFFYTPK^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-DGGAWGTEQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-LVLATGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide Biot-PRKVIKMESEE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NNPFYFPSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Peptide Ac-HHHHHHC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-SGTDVDAANL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Z-Leu-Arg-AMC is an ion channel activator that belongs to the group of peptides. It is a high purity reagent for use in research, which can be used as a pharmacological tool and as a research tool for studying protein interactions. Z-Leu-Arg-AMC is also an inhibitor of peptidases, such as chymotrypsin, trypsin, and elastase.<br>Z-Leu-Arg-AMC has been shown to activate voltage gated potassium channels by binding to the extracellular domains of these channels. This activation leads to the opening of potassium channels and an increase in potassium efflux from cells.</p>

<p>Peptide H-IILEALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-AGQAVDDFIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide LCBiot-AAKIQASFRGHMARKK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

Peptide H-LTWASHEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YML^DLQPETT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KISQTAQTYDPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>

<p>Peptide H-ADQLADESLESTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

<p>Peptide H-PPYTIVYFPVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>

The ME™ Kit is used for specific isolation of extracellular vesicles (exosomes, microvesicles) in as little as 45 minutes using a standard bench top centrifuge. This product is optimized for urine or media samples and contains the 1mg Vn96 peptide (enough for 20x samples), 500µl ME buffer, a negative control (100µg Vn96 scrambled peptide) and 50µl purified exosomes from HEK293 cells as positive control.Extracellular vesicle isolation, is becoming essential in diagnostics and therapeutics. These small membrane-enclosed particles play important roles in many biological processes, including communication, immune response, tissue regeneration, and tumor progression. They are also being studied for their use as biomarkers for various diseases and as potential therapeutics against cancer, neurodegenerative disorders, and inflammatory conditions. It is becoming known that blood profiling alongside exosome analysis provides scientists with suitable resources to monitor disease progression. To combat the challenges associated with exosome isolation Cymit Quimica have developed two ME™ Kits, available for purchase online based on optimization for how different sample types behave: urine or media samples (ME-020) and plasma samples (ME-020P). Our technique produces results comparable to ultracentrifugation, but at much greater efficiency as 1/30th the sample size is required, fulfilling the needs of the diagnostic and pharma industries. The underlaying mechanisms of how the kit works – an affinity for canonical HSPs – may allow for this to be applied fairly broadly, since HSPs are roundly conserved from bacteria to higher order mammals.For more information on the effectiveness and flexibility of this extracellular isolation technology read our publication (Gosh, 2014).