
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30292 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
LCBiot-SPDVDLGDISGINAS-OH
Peptide LCBiot-SPDVDLGDISGINAS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DPGVLDR^-OH
Peptide H-DPGVLDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ANALLANGVELR^-OH
Peptide H-ANALLANGVELR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-NNN-NH2
Peptide Ac-NNN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NL^VPMVATV-OH
Peptide H-NL^VPMVATV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YMEDSTYYK^-OH
<p>Peptide H-YMEDSTYYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GLAR-OH
<p>Peptide Ac-GLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TDEGIAYR^-OH
<p>Peptide H-TDEGIAYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELLETVV^NR-OH
<p>Peptide H-ELLETVV^NR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-NNPVLIGEPGVGK^-OH
<p>Peptide H-NNPVLIGEPGVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LGAEVYHTLK^-OH
<p>Peptide H-LGAEVYHTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Cyc-Ac-YCWSQYLCY-NH2
<p>Peptide Cyc-Ac-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DIYKGVYQFKSV-OH
<p>LCMV CD4 epitope peptide GP66–77 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C69H103N15O19Molecular weight:1,446.65 g/molH-ALGSHHTASPWNLSPFSK^-OH
<p>Peptide H-ALGSHHTASPWNLSPFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RPPGFSPF^R-OH
Peptide H-RPPGFSPF^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-LKIQNRQAAASY-OH
<p>Peptide Biot-LKIQNRQAAASY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQEEIDAVLPNK^-OH
<p>Peptide H-LQEEIDAVLPNK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>C-Peptide 2 (rat)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C135H222N38O49Molecular weight:3,161.5 g/molH-LTFPTGR^-OH
Peptide H-LTFPTGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-MFL^SFPTTK-OH
<p>Peptide H-MFL^SFPTTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LQDVHNFVALGAPLAPR^-OH
<p>Peptide H-LQDVHNFVALGAPLAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RVYI^HPFHL-OH
<p>Peptide H-RVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EDSQCVIGLYQPPLQVY-NH2
<p>Peptide H-EDSQCVIGLYQPPLQVY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Myr-FTEIPTI^-OH
Peptide Myr-FTEIPTI^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SAEGLDASASLR^-OH
Peptide H-SAEGLDASASLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.pE-HWSYGLRPG-OH
<p>Peptide pE-HWSYGLRPG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-AKRHRKVLRD-NH2
<p>Peptide Ac-AKRHRKVLRD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Pro-Gly-OH
CAS:<p>Fmoc-Pro-Gly-OH is an antimicrobial agent that binds to bacterial cell walls and prevents the bacteria from assembling. It has a conformation that mimics the structure of thioether antibiotics, which are unilamellar and assembled. Fmoc-Pro-Gly-OH inhibits the pyrophosphate binding site, preventing the synthesis of ATP in bacteria. This drug also has affinity for alkene binders, which may be due to its structural similarity to these compounds.</p>Formula:C22H22N2O5Purity:Min. 95%Color and Shape:PowderMolecular weight:394.42 g/molH-LDIDSAPITAR^-OH
<p>Peptide H-LDIDSAPITAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GNPTVEVDLFTSK^-OH
<p>Peptide H-GNPTVEVDLFTSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HYFIAAVER^-OH
<p>Peptide H-HYFIAAVER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GFPGIQGR^-OH
<p>Peptide H-GFPGIQGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>VIP Antagonist
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C154H257N49O40SMolecular weight:3,467.13 g/molH-VPQVSTPTLVEVSR^-OH
<p>Peptide H-VPQVSTPTLVEVSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FKDLGEENFK^-OH
<p>Peptide H-FKDLGEENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-GGLNDIFEAQKIEWHED-NH2
<p>Peptide Ac-GGLNDIFEAQKIEWHED-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-SVQEIQATFFYFTPNK^TEDTIFLR^-OH
<p>Peptide H-SVQEIQATFFYFTPNK^TEDTIFLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EIPISINYR^-OH
Peptide H-EIPISINYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.(Asn670,Sta671,Va672)-Amyloid β/A4 Protein Precursor770 (662-675) ammonium salt
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C73H118N16O27Molecular weight:1,651.83 g/molH-NSSVSGIFTFQK^-OH
<p>Peptide H-NSSVSGIFTFQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>LCBiot-VHWDFRQWWQPS-OH
Peptide LCBiot-VHWDFRQWWQPS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TAFQEALDAAGDK^-OH
<p>Peptide H-TAFQEALDAAGDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Abz-frk(dnp)-P
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C39H49N11O10Molecular weight:831.4 g/molH-IKGEHPGLSIGDVAK^-OH
<p>Peptide H-IKGEHPGLSIGDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GAL^^QNIIPASTGAAK-OH
<p>Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AEEDEILNR^-OH
<p>Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QVYSLIRPNENPAHK-OH
Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-QLYENKPRRPYIL^-OH
Peptide H-QLYENKPRRPYIL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.V14 Peptide
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,356.5 g/molCMVpp65 - 84 (IRETVELRQYDPVAA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,760 g/molH-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH
<p>Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>His-Tyr-Phe-Lys-Thr-Arg-His-Tyr-Leu
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C61H85N17O13Molecular weight:1,264.43 g/molPuma2A peptide
<p>PUMA2A is a modified version of the PUMA peptide, a pro-apoptotic protein that promotes cell death. PUMA normally activates proteins like BAK and BAX, which cause mitochondrial damage and trigger apoptosis. However, PUMA2A has two alanine substitutions that render it inactive. It's often used as a negative control in experiments studying apoptosis, as it should not induce cell death. This is because the BCL-2 family of proteins, which includes PUMA, are crucial regulators of apoptosis, and disrupting their function can impact cell survival.</p>Ac-CDDINVDRENRRELVAK-NH2
<p>Peptide Ac-CDDINVDRENRRELVAK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-FLLP^TGAEA-OH
<p>Peptide H-FLLP^TGAEA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-RQIKIWFQNRRMKWKK-bMPAthioester
<p>Peptide H-RQIKIWFQNRRMKWKK-bMPAthioester is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ranatensin
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C61H85N16O13SMolecular weight:1,281.5 g/molHLA-A2 140-149 (HLA-A*02:01)
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-Phe-Met-Arg-Phe-NH2 acetate
CAS:Controlled Product<p>H-Phe-Met-Arg-Phe-NH2 acetate is a high quality reagent that is useful in the synthesis of complex compounds. It can be used as an intermediate for the production of fine chemicals and speciality chemicals, as well as being a versatile building block in the synthesis of organic compounds. H-Phe-Met-Arg-Phe-NH2 acetate can also be used to make research chemicals or reaction components.</p>Formula:C29H42N8O4S•(C2H4O2)xPurity:Min. 95%Color and Shape:PowderMolecular weight:598.76 g/molH-V^V^GGL^V^ALR^-OH
<p>Peptide H-V^V^GGL^V^ALR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LLHGFSFYL^-OH
<p>Peptide H-LLHGFSFYL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDDLIKVVEELTRIH-OH
Peptide Ac-CDDLIKVVEELTRIH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAEGLDTQR^-OH
<p>Peptide H-AAEGLDTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GDPGLIGPK^-OH
<p>Peptide H-GDPGLIGPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-DRV^YIHP-OH
<p>Peptide H-DRV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CETVSTQELYS-NH2 PAB-403-404C6
<p>Peptide Ac-CETVSTQELYS-NH2 PAB-403-404C6 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-GEGIEEFLR-OH
<p>Peptide H-GEGIEEFLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C46H72N12O16Molecular weight:1,049.16 g/molMelanostatin DM
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C41H58N14O6Molecular weight:843 g/molH-STQAAIDQINGK^-OH
Peptide H-STQAAIDQINGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-IRIKIRIK-NH2
<p>Peptide Ac-IRIKIRIK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-APGLTQALNTK^-OH
<p>Peptide H-APGLTQALNTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH
Peptide 5,6Fam-YGRKKRRQRRRYKEGYNVYG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ile-Val-Tyr-Arg-Asp-Gly-Asn-Pro-Tyr-Ala
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C53H78N14O16Molecular weight:1,167.27 g/molH-ASDPSLK^-OH
<p>Peptide H-ASDPSLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-EALAENNLNLPK^-OH
<p>Peptide H-EALAENNLNLPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Sudocetaxel zendusortide
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C179H248N28O57Molecular weight:3,704.03 g/molAc-CSEGEKARKNIVLARRRP-NH2
Peptide Ac-CSEGEKARKNIVLARRRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AEWEQK^-OH
Peptide H-AEWEQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.SIVmac239 - 67
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,908.3 g/molBim BH3 (52-71) acid
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolH-IALGGLLFPASNL^R^-OH
Peptide H-IALGGLLFPASNL^R^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTNY^T-OH
<p>Peptide H-TTNY^T-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C25H38N6O11Molecular weight:599.63 g/molH-TIAIIAEGIPEALTR^-OH
<p>Peptide H-TIAIIAEGIPEALTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ATLTVDK^-OH
<p>Peptide H-ATLTVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-AVPI-NH2
<p>Peptide H-AVPI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ELPLYR^-OH
Peptide H-ELPLYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-GTRIIYDRKFLMECRN-NH2
Peptide Ac-GTRIIYDRKFLMECRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TITTDLLGSPFQEK^-OH
<p>Peptide H-TITTDLLGSPFQEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-LDTLAQEVALLK^-OH
<p>Peptide H-LDTLAQEVALLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>HXB2 gag NO-118
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Molecular weight:1,724.9 g/molH-AQQHYPVSAGYTK^-OH
<p>Peptide H-AQQHYPVSAGYTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CMQNPYSRHSSMPRPDY-OH
<p>Peptide Ac-CMQNPYSRHSSMPRPDY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-QVPLRPMTYK-NH2
Peptide Ac-QVPLRPMTYK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-ELSWSADSIRLQISNPD-NH2
<p>Peptide Ac-ELSWSADSIRLQISNPD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-WTLTAPPGYR^-OH
<p>Peptide H-WTLTAPPGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-KITDFGRAK^-OH
<p>Peptide H-KITDFGRAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>BH3 BIM (52 - 71)
<p>The BH3 BIM (52-71), human peptide is a synthetic peptide derived from the BIM protein (Bcl-2-like protein 11), which is a member of the BH3-only family of pro-apoptotic proteins. This specific peptide corresponds to amino acids 52 to 71 of the human BIM protein, and it contains the BH3 domain—a critical region responsible for its interaction with anti-apoptotic members of the Bcl-2 family, such as Bcl-2, Bcl-xL, and Mcl-1.<br>The BH3 domain is essential for the pro-apoptotic function of BIM. It binds to anti-apoptotic proteins, neutralizing their activity and allowing pro-apoptotic proteins like Bax and Bak to promote mitochondrial outer membrane permeabilization (MOMP), which leads to apoptosis (programmed cell death). This mechanism is crucial in regulating cell death, especially in cancer and other diseases where apoptosis is dysregulated.</p>Formula:C110H173O31N33S1Molecular weight:2,485.9 g/molH-ILKEPVHGV^-OH
Peptide H-ILKEPVHGV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CGPENGRRGGFGSRG-NH2 PAB-207-1713
<p>Peptide H-CGPENGRRGGFGSRG-NH2 PAB-207-1713 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-ESL^^SSYWESAK-OH
<p>Peptide H-ESL^^SSYWESAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>
