Peptides
Subcategories of "Peptides"
Found 29907 products of "Peptides"
H-HAKRRLIF-NH2
Peptide H-HAKRRLIF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EFMVFAHAQWK^-OH
Peptide H-EFMVFAHAQWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AELQ^EGAR-OH
Peptide H-AELQ^EGAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GYPG-NH2
Peptide H-GYPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH
Peptide LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SLYSYFQK^V-OH
Peptide H-SLYSYFQK^V-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-PLILLRLLRGQFC-NH2
Peptide H-PLILLRLLRGQFC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-STVHEILCKLSLEG-NH2
Peptide Ac-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FQTFEGDLK^-OH
Peptide H-FQTFEGDLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
[5-FAM]-IFN-γ receptor (pTyr) peptide
Signal transducers and activators of transcription 1 (STAT1) binding peptide. STAT1 is a biotinylated protein that contains an SH2 domain, which binds to specific phospho (pY)-containing peptide motifs. Interferon &γ- (IFN&γ-/type II IFN) activates STAT1 by its phosphorylation. STAT1 is a critical mediator of cytokine signalling and has been reported as a tumour suppressor in breast cancer, myeloma and leukaemia.IFN&γ- is secreted by immune cells and signals through the IFN&γ- receptor and downstream signalling pathways including the janus kinase (JAK)/STAT pathway. IFN&γ- is a central mediator of the adaptive immune system and regulates macrophage activation to promote the expression of high levels of pro-inflammatory cytokines (Il-1β, IL-12, IL-23, and TNF-α)- production of reactive nitrogen and oxygen intermediates- promotion of CD4+ T helper 1 (Th1) cell response and strong inflammatory activity. IFN&γ- inhibits viral replication and is essential for vaccine-mediated immune responses. IFN&γ- signalling is usually short-lived to elicit recovery of homeostasis, including tissue repair, however IFN-&γ- is elevated in severe adult asthma and is present in the airways of children with severe asthma. This indicates a key role for IFN&γ- in inflammatory conditions.Peptide contains a phosphorylated tyrosine residue and an N-terminal 5-carboxyfluorescein (5-FAM), a widely used green fluorescent tagMolecular weight:1,364.5 g/molH-ALPMHIR^-OH
Peptide H-ALPMHIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-LMKNMDPLNDNV-NH2
Peptide Ac-LMKNMDPLNDNV-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Rhod-HIPRT-OH
Peptide Rhod-HIPRT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VSFELFADK^-OH
Peptide H-VSFELFADK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TESTLNALLQR^-OH
Peptide H-TESTLNALLQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-NNNN-OH
Peptide Ac-NNNN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-Phe-Thiaphe-OH
CAS:Ac-Phe-Thiaphe-OH is a molecule that inhibits the activity of nerve growth factor (NGF) by binding to the NGF receptor. It has been shown to be effective in reducing oxidative stress and nerve injury. Ac-Phe-Thiaphe-OH also has a molecular target for cancer, as it binds to the epidermal growth factor receptor and blocks the epidermal growth factor from binding to the receptor. This leads to a decrease in cancer cell proliferation and an increase in apoptosis. Ac-Phe-Thiaphe-OH also binds to serotonin receptors and reduces pancreatic cancer cells in culture. The molecule is currently under development as a potential treatment for pancreatic cancer.
Formula:C19H20N2O4SPurity:Min. 95%Molecular weight:372.44 g/molH-STGGAPTFNVTVTK^-OH
Peptide H-STGGAPTFNVTVTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RV^YIHPFHL-OH
Peptide H-RV^YIHPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Liraglutide acetate
CAS:Liraglutide is a glucagon-like peptide-1 analog that has been shown to be an effective treatment for obesity. Liraglutide targets the adipose tissue and reduces the amount of glucose in the blood by increasing insulin sensitivity, lowering food intake, and reducing appetite. In addition, Liraglutide has been shown to suppress postprandial hyperglycemia and lower plasma glucose levels in patients with type 2 diabetes mellitus. Liraglutide also inhibits neuronal death induced by apoptotic stimuli, which may have potential use as a model system for neurodegenerative diseases such as Parkinson's disease. Liraglutide has also been shown to be an effective therapy for infectious diseases including Crohn's disease and ulcerative colitis. This drug has shown some effectiveness against atherosclerosis in animal models by inducing apoptosis in macrophages that are associated with lesions.Formula:C172H265N43O51Purity:Min. 95%Molecular weight:3,751.29 g/molH-SADTLWGIQK^-OH
Peptide H-SADTLWGIQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TNYLTHR^-OH
Peptide H-TNYLTHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AVQQPDGLAVLGIFLK^-OH
Peptide H-AVQQPDGLAVLGIFLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-GGMEDIYFEFMGGKKK-NH2
Peptide Ac-GGMEDIYFEFMGGKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
R-S-R
Peptide R-S-R is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C15H31N9O5Molecular weight:417.5 g/molH-SEQLGGDVESYDK^-OH
Peptide H-SEQLGGDVESYDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-Ser-Phe-Leu-Leu-Arg-Asn-OH
CAS:H-Ser-Phe-Leu-Leu-Arg-Asn-OH is a biocompatible polymer that has been shown to have strong antioxidative properties. This polymer has been used in the development of a new class of drug for the treatment of inflammatory bowel disease, which may be due to its ability to inhibit toll-like receptor activity. H-Ser-Phe-Leu-Leu-Arg-Asn-OH also has potent immunosuppressive and antiinflammatory activities, and is stable at doses up to 200mg/kg. These properties make this polymer an attractive candidate for use as a therapeutic agent in treating bowel disease.Formula:C34H56N10O9Purity:Min. 95%Molecular weight:748.87 g/molH-NPATTNQTEFER^-OH
Peptide H-NPATTNQTEFER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ile-Val-Ile
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C17H33N3O4Molecular weight:343.46 g/molH-GPRP-NH2
Peptide H-GPRP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDVHYAPTIR^-OH
Peptide H-LDVHYAPTIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-EAQQHLLQLT-NH2
Peptide LCBiot-EAQQHLLQLT-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-KKKSPGEYVNIEFG-OH
Peptide Biot-KKKSPGEYVNIEFG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GQPLSP^EK^-OH
Peptide H-GQPLSP^EK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AGVETTTPSK^-OH
Peptide H-AGVETTTPSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LHVDPENFR^-OH
Peptide H-LHVDPENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YMEDSTYYK^-OH
Peptide H-YMEDSTYYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QFPILLDFK^-OH
Peptide H-QFPILLDFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IAQLEEQLDNETK^-OH
Peptide H-IAQLEEQLDNETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2
Peptide Ac-FAOOFAOOFOOFAOOFAOFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
FMRF-like neuropeptide flp-4-2
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C44H66N12O10Molecular weight:923 g/molH-ATGIPDR^-OH
Peptide H-ATGIPDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VSQYIEWLQK^-OH
Peptide H-VSQYIEWLQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLPSDFFPSV^-OH
Peptide H-FLPSDFFPSV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Synthetic SAA1 (1-76) protein (Human)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:8,575.21 g/molAc-Qpy-NH2
Peptide Ac-Qpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LQDVHNFVALGAPLAPR^-OH
Peptide H-LQDVHNFVALGAPLAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALQVVR^-OH
Peptide H-ALQVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FKDLGEENFK^-OH
Peptide H-FKDLGEENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Angiotensin II, human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C50H71N13O12Molecular weight:1,046.19 g/molH-LQSLFDSPDFSK^-OH
Peptide H-LQSLFDSPDFSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Fam-YGGFLRRIRPKLKWDNQ-OH
Peptide 5Fam-YGGFLRRIRPKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Met-2-ClTrt-Resin (100-200 mesh) 1% DVB
H-Met-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin for peptide synthesis. It is a new, high yielding building block for the production of peptides by solid phase synthesis. The resin can be used as a building block for the synthesis of amines, alcohols, and thiols.Purity:Min. 95%H-VVGAGDVGK^-OH
Peptide H-VVGAGDVGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRV^YIHP-OH
Peptide H-DRV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 112
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,506.7 g/molH-VLDGLDVLL^-OH
Peptide H-VLDGLDVLL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TPAYYPNAGLI^K-OH
Peptide H-TPAYYPNAGLI^K-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNALKPDNR^-OH
Peptide H-LNALKPDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Pr-EIR-OH
Peptide Pr-EIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LGADMEDV^R-OH
Peptide H-LGADMEDV^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LNVETDTAEIR^-OH
Peptide H-LNVETDTAEIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Trp-Glu-His-Asp-H (aldehyde)
CAS:Ac-Trp-Glu-His-Asp-H (aldehyde) is a synthetic peptide that is used as a research tool for pharmacology. It is an activator of ion channels and has been shown to inhibit the activity of protein interactions. Ac-Trp-Glu-His-Asp-H (aldehyde) also shows high purity and no detectable impurities in the final product.
Formula:C28H33N7O9Purity:Min. 95%Molecular weight:611.6 g/molH-NTTGALTTR^-OH
Peptide H-NTTGALTTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YARAAARQARAKAL^ARQL^GVAA-OH
Peptide H-YARAAARQARAKAL^ARQL^GVAA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AIHELIQVMAELSPAAK^-OH
Peptide H-AIHELIQVMAELSPAAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-KLTWQELYQLKYKGI-NH2
Peptide Ac-KLTWQELYQLKYKGI-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp
CAS:Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp is a peptide that belongs to the group of picolinic acid. It has been shown to cause neuronal death and synergistic cell lysis in vitro. Abz-Ala-Phe-Arg-Phe-Ser-Gln-EDDnp inhibits the mitochondrial membrane potential, which leads to cytochrome c release, caspase activation, and subsequent apoptosis. Abz also inhibits basic protein synthesis and causes proteolytic degradation of cellular proteins.Formula:C50H63N15O13Purity:Min. 95%Molecular weight:1,082.15 g/molDnp-FAQSIPK-AMC
Peptide Dnp-FAQSIPK-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-R^DSSWSETSEASYSGL-OH
Peptide H-R^DSSWSETSEASYSGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ILAGPAGDSNVVK^-OH
Peptide H-ILAGPAGDSNVVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CVVRLKRVSLPKTKPAQ-NH2
Peptide Ac-CVVRLKRVSLPKTKPAQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 18 (HRGDNQLQVQHTYFT)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,844 g/molH-EQVTNVGGAVVTGVTAVAQK^-OH
Peptide H-EQVTNVGGAVVTGVTAVAQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HTSVQTTSSGSGPFTDVR^-OH
Peptide H-HTSVQTTSSGSGPFTDVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QLLLSAALSAGK^-OH
Peptide H-QLLLSAALSAGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-LCTPSR-NH2
Peptide Ac-LCTPSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
GAD65 (206-220)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C86H129N15O24Molecular weight:1,757.07 g/molSIVmac239 - 111
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,695 g/molH-FVEEIIEETK^-OH
Peptide H-FVEEIIEETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LGHPDTLNQGEFK^-OH
Peptide H-LGHPDTLNQGEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Fmoc-Ala-Gly-OH
CAS:Fmoc-Ala-Gly-OH is a building block for peptide synthesis and Fmoc protected l-amino acid. It is an amino acid that belongs to the group of Fmoc protected l-amino acids. This amino acid can be used as a building block for peptide synthesis, which is a technique for the chemical synthesis of peptides. The general method involves the activation of carboxyl groups on one end of the growing peptide chain with an activating agent such as dicyclohexylcarbodiimide or diisopropylcarbodiimide. The activated carboxyl group reacts with an amine (or ammonia) to form an amide bond, linking the new molecule to the preceding one in the chain. This reaction produces a molecule with a free carboxyl group at one end, which can then repeat the process.
Formula:C20H20N2O5Purity:Min. 95%Molecular weight:368.39 g/molH-ADLSGITGAR^-OH
Peptide H-ADLSGITGAR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SH2 Domain Ligand (2)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C66H97N12O24PMolecular weight:1,473.57 g/molH-YPLIQTLR^-OH
Peptide H-YPLIQTLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
5Tamra-RRRRRRRRR-NH2
Peptide 5Tamra-RRRRRRRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TVFHFRLL-NH2
Peptide H-TVFHFRLL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IL^DTAGL^EEY-OH
Peptide H-IL^DTAGL^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-1-[(2S)-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-4-methylpentanoyl]am ino]-3-methylbutanoyl]pyrrolidine-2-carbonyl]amino]-4-methylsulfanylbutanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C42H74N10O12SMolecular weight:943.18 g/molH-YIQDIVASTLK^-OH
Peptide H-YIQDIVASTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Dynorphin A (1-17)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C99H155N31O23Molecular weight:2,147.5 g/molExendin (9-39)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C149H234N40O47SMolecular weight:3,369.79 g/molH-PAFSAIR^-OH
Peptide H-PAFSAIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB
H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB is a building block for peptide synthesis. It is a resin that contains amines and thiols. H-ß-Ala-2-ClTrt-Resin (200-400 mesh) 1% DVB also has the tools for peptide synthesis, such as alcohols and resins.
Purity:Min. 95%S-Trityl-ß-Mercaptopropionyl-AM Resin
S-Trityl-ß-Mercaptopropionyl-AM Resin is a resin that can be used for peptide synthesis. It is used in the building blocks of protein, and its ligation is used to build peptides. This resin is a building block for protein synthesis and can be used as an alternative to Fmoc-protected amino acids.Purity:Min. 95%Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H24N4O6S1Molecular weight:364.42 g/molProTx-II
CAS:A spider venom-derived peptide whose sequence is derived from the Tarantula, Thrixopelma pruriens which can be applied as a Na+ Channel (Especially Nav1.7) / Ca2+ Ion Channel Blocker (Gating Modifier). This product has disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 and is available as a trifluoroacetate salt. For a smaller quantity in acetate form, see PTX-4450-S.
Formula:C168H250N46O41S8Purity:Min. 95%Molecular weight:3,826.66 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Neurotoxin NSTX-3
CAS:A synthetic spider venom toxin sourced from the Papua New Guinean Spider, Nephila maculata. This product may have potential in pharmaceutical applications, such as in ion channel research.
Formula:C30H52N10O7Purity:Min. 95%Molecular weight:664.8 g/mol
![[5-FAM]-IFN-γ receptor (pTyr) peptide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1100416.webp&w=3840&q=75)
