
Peptides
Subcategories of "Peptides"
Found 29844 products of "Peptides"
Myr-RWKFGGFKWR-OH
Peptide Myr-RWKFGGFKWR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ALLPAVPSL^-OH
Peptide H-ALLPAVPSL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ENQLEVLEVSWLHGLK^-OH
Peptide H-ENQLEVLEVSWLHGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5FAM-EDIIRNIARHLAQVGDSMDR-OH
Peptide 5FAM-EDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CMVpp65 - 115 (KAESTVAPEEDTDED)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,635.6 g/molH-ISQAVHAAHAEINEAGR-cysteamide
Peptide H-ISQAVHAAHAEINEAGR-cysteamide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YSFLQFDPAPR^-OH
Peptide H-YSFLQFDPAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HIV - 1 MN ENV - 55
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,582.9 g/molH-IIPGGIYNADLNDEWVQR^-OH
Peptide H-IIPGGIYNADLNDEWVQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.5Fam-EEPLYWSFPAKKK-NH2
Peptide 5Fam-EEPLYWSFPAKKK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SLGR-CMK
Peptide Ac-SLGR-CMK is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TSESGELHGLTTEEEFVEGIYK^-OH
Peptide H-TSESGELHGLTTEEEFVEGIYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CMVpp65 - 130 (ANDIYRIFAELEGVW)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,796 g/molH-LVLEVAQHLGESTVR^-OH
Peptide H-LVLEVAQHLGESTVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.AF-1
Peptide AF-1 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C45H69N13O10Molecular weight:3,576.06 g/molH-RHPDYSVVLLLR^-OH
Peptide H-RHPDYSVVLLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YDVDTLDMVFLDHWK^-OH
Peptide H-YDVDTLDMVFLDHWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SLSLSLGK^-OH
Peptide H-SLSLSLGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VAIDAGYR^-OH
Peptide H-VAIDAGYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 80
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,748 g/molAc-CRRVIGAKKDQY-NH2
Peptide Ac-CRRVIGAKKDQY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TIAQDYGVLK^-OH
Peptide H-TIAQDYGVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CEA 605-613 mutant (HLA-A*02:01) 610D
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C43H68N10O15Molecular weight:965.08 g/molCMVpp65 - 52 (VCSMENTRATKMQVI)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,711.1 g/molH-LFDSLTLLASGR^-OH
Peptide H-LFDSLTLLASGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.IL 13 Human
IL-13 is a cytokine that belongs to the IL-4 family of cytokines. IL-13 is an activator of B cells and mast cells. It binds to the IL-4 receptor and can activate lymphocytes, macrophages, eosinophils, basophils, and neutrophils. This cytokine has been shown to inhibit ion channels in airway epithelium cells and also bind to the alpha1 subunit of the N-methyl d-aspartate receptor. IL-13 is also a ligand for the IL-4 receptor, which may be important for its function as a regulator of other cytokines such as TNFα or IFNγ.Purity:>95% By Sds-Page And Rp-Hplc.H-TLDFHDSNVK^-OH
Peptide H-TLDFHDSNVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DQIPELENNEK^-OH
Peptide H-DQIPELENNEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SHLVEALYLVCGERG-NH2
Peptide H-SHLVEALYLVCGERG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NILEASYDTK^-OH
Peptide H-NILEASYDTK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-NKPQFLAGAASLLR^-OH
Peptide H-NKPQFLAGAASLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GGVEVLEVK^-OH
Peptide H-GGVEVLEVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ELLETVVNR^-OH
Peptide H-ELLETVVNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-HLSLLTTLSNR^-OH
Peptide H-HLSLLTTLSNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
CFTR (108-117), Pseudomonas aeruginosa Inhibitor
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C51H77N15O22Molecular weight:1,252.27 g/molH-VEEVSLRK^-OH
Peptide H-VEEVSLRK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Boc-RRR-OH
Peptide Boc-RRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VFDEFKPL^VEEPQNL^IK-OH
Peptide H-VFDEFKPL^VEEPQNL^IK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FNPLDPFVLSIK^-OH
Peptide H-FNPLDPFVLSIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Caspase-5-derived FSP (67-75)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolLCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH
Peptide LCBiot-KRKLIVDSVKELDSKTIRAQLSDYS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SPVVSGDTSPR^-OH
Peptide H-SPVVSGDTSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DLTDYLMK^-OH
Peptide H-DLTDYLMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
LCBiot-LVVVGACGVGK-OH
Peptide LCBiot-LVVVGACGVGK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.TMSB4Y (Human) Recombinant Protein
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-GDTGETGVTGVEGPR^-OH
Peptide H-GDTGETGVTGVEGPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LVAYYTLIGASGQR^-OH
Peptide H-LVAYYTLIGASGQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KFRKAFKRFF-NTPEGBiot
Peptide H-KFRKAFKRFF-NTPEGBiot is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Amyloid β-Protein (1-16)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolFormula:C84H119N27O28Molecular weight:1,955 g/molCMVpp65 - 113 (GVMTRGRLKAESTVA)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Molecular weight:1,575.9 g/molLeptin (93-105) (human)
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C64H110N20O23Molecular weight:1,527.8 g/molTH006 - Tau degrader
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:3,780.1 g/molBiot-SGRPRTTSFAESCKP-NH2
Peptide Biot-SGRPRTTSFAESCKP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Cyc-Biot-YCWSQYLCY-NH2
Peptide Cyc-Biot-YCWSQYLCY-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CR-NH2
Peptide H-CR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Lys-Asp-Cys
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C13H24N4O6S1Molecular weight:364.42 g/molH-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2
Peptide H-EAEEFFELISKAQSNRADDQRGLLRKEDLVLPEFLR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DLPMSPR^-OH
Peptide H-DLPMSPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FFEILSPVYR^-OH
Peptide H-FFEILSPVYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIYETDYYR^-OH
Peptide H-DIYETDYYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALAAELNQLR^-OH
Peptide H-ALAAELNQLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LTVLGQPK^-OH
Peptide H-LTVLGQPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
HXB2 gag NO-19/aa73 - 87
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,775 g/molH-GSISIQTEEK^-OH
Peptide H-GSISIQTEEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLVVYPWTQR^-OH
Peptide H-LLVVYPWTQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-QEQLERALNSS-OH
Peptide Ac-QEQLERALNSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CMPEEGFKGTGLLGH-OH
Peptide Ac-CMPEEGFKGTGLLGH-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AKPALEDL^R-OH
Peptide H-AKPALEDL^R-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Nesfatin-1 (Human)
Nesfatin-1 is a peptide hormone that is synthesized in the brain, pancreas, and gut. It can be found in human plasma and cerebrospinal fluid. Nesfatin-1 has been shown to decrease food intake through its effects on the hypothalamus. This peptide hormone also stimulates insulin secretion from pancreatic beta cells, which may be due to its ability to inhibit the release of glucagon. Nesfatin-1 has been shown to have a strong effect on glucose homeostasis and may be used as an adjunct therapy for diabetes mellitus type 2 patients who are resistant to metformin treatment.Formula:C427H691N113O134Purity:Min. 95%Molecular weight:9,551.95 g/molMage-1 Antigen (161-169), human
CAS:Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C41H57N11O17Molecular weight:975.97 g/molMYH9 741-749 (HLA-A*02:01)
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-FL^PEFGISSA-OH
Peptide H-FL^PEFGISSA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-SGVGNDLVL-NH2
Peptide Ac-SGVGNDLVL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.LCBiot-LSALTPSPSWLKYKAL-NH2
Peptide LCBiot-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-PLLA-OH
Peptide Ac-PLLA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-EEMQRR^-NH2
Peptide Ac-EEMQRR^-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
IGF1 N15 Human
IGF1 N15 Human is a desiccated, freeze-dried protein that is stable isotope and suitable for use in metabolic studies. IGF1 N15 Human has the same amino acid sequence as human insulin-like growth factor 1 (IGF1). IGF1 N15 Human can be used to study cell proliferation, sulfation, and sulfate conjugation. This protein is also used in Cytokines research as an alternative to recombinant human IGF1. Reconstitute with water or buffer prior to use.Purity:>97% By Sds-Page And Rp-Hplc.H-LCTP^SR-OH
Peptide H-LCTP^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.CY5-SE triethylamine salt
CAS:CY5-SE triethylamine salt (Fluorolink Cy5 triethanolamine salt) is a hydrophilic amine-reactive fluorescent probe (Ex=649 nm; Em=670 nm).Formula:C43H58N4O10S2Purity:97.03% - 98.07%Color and Shape:SolidMolecular weight:855.07Acetyl-L-phenylalanine Ethyl Ester
CAS:Controlled ProductApplications Acetyl-L-phenylalanine ethyl ester is a derivative of L-Phenylalanine (P319415), a nonpolar, essential amino acid that naturally occurs in the human body and is also used to treat patients with depression. Acetyl-L-phenylalanine ethyl ester is also used to inhibit pepsin-catalyzed reactions.
References Auer, H. & Doty, P.: Biochemistry, 5, 1708 (1966); Birkmayer, W., et al.: J. Neural Transm., 59, 81 (1984); Borison, R., et al.: Res. Commun. Chem. Path., 21, 363 (1978); Kitson, T., et al.: Biochem. J., 122, 241 (1971)Formula:C13H17NO3Color and Shape:NeatMolecular weight:235.28Boc-L-His(Tos)-OH
CAS:Controlled ProductApplications Boc-L-His(Tos)-OH, is an amino acid building block used in peptide synthesis. With a growing peptide drug market the fast, reliable synthesis of peptides is of great importance.
Formula:C18H23N3O6SColor and Shape:NeatMolecular weight:409.46Cyanoacetic Acid-13C2
CAS:Controlled ProductApplications Cyanoacetic Acid-13C2 is an intermediate for the synthesis of Diclazuril-13C3,15N2 (D436202), which is the labelled analogue of Diclazuril (D436200). Diclazuril is a nucleotide analogue with broad-spectrum anticoccidial activity and a coccidiostat.
References Maes, L., et al.: J. Parasitol., 74, 931 (1988)Formula:C13C2H3NO2Color and Shape:NeatMolecular weight:87.05N-L-α-Glutamyl-L-glutamic Acid
CAS:Controlled ProductFormula:C10H16N2O7Color and Shape:NeatMolecular weight:276.24c-Myc tag Peptide
c-Myc Peptide displaces c-Myc-tagged proteins from antibodies, proving specific binding and regulating gene transcription.Formula:C51H86N12O21Purity:98%Color and Shape:SolidMolecular weight:1203.3ACTGSTQHQCG-NH2
Peptide ACTGSTQHQCG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C40H63N15O17S2Molecular weight:1,090.16 g/molH-RAHYNIVTFCCKCDS-OH
Peptide H-RAHYNIVTFCCKCDS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-RGDSPASSPK^-OH
Peptide H-RGDSPASSPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Molecular weight:1,009.07 g/molH-TESTT-OH
Peptide H-TESTT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLGEFLKLDRERAKN-OH
Peptide H-TLGEFLKLDRERAKN-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-CRRRRRRRR-OH
Peptide H-CRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-STTVKAACWW-OH
Peptide H-STTVKAACWW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DIVGAVLK-OH
Peptide H-DIVGAVLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-AGEALYE-OH
Peptide H-AGEALYE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-YMLDLQPETTDL-OH
Peptide H-YMLDLQPETTDL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTITAGSK-OH
Peptide H-FTITAGSK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KSWMESEF-OH
Peptide H-KSWMESEF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AAAAAAAAAAAAA-OH
H-AAAAAAAAAAAAA-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-LRRGQILWFRGLNRIQTQIK-OH
CAS:Peptide H-LRRGQILWFRGLNRIQTQIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Formula:C113H190N38O26Molecular weight:2,497 g/molH-PPPP-OH
Peptide H-PPPP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CSSSIINFEKL-OH
Modified H-2kb tetramer peptide for further modification (e.g. addition of N-term tag)


