
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30471 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
cAC 253
<p>Amylin antagonist AMY3, IC50 0.3 μM, shields neurons from Aβ toxicity, brain-penetrant, boosts memory, lowers Aβ plaques in Alzheimer's mice.</p>Formula:C126H202N42O40S2Purity:98%Color and Shape:SolidMolecular weight:3009.36Tos-Gly-Pro-Arg-ANBA-IPA acetate
CAS:<p>Tos-Gly-Pro-Arg-ANBA-IPA (acetate) is a peptide substrate for luminescence measurement.</p>Formula:C32H45N9O10SPurity:98%Color and Shape:SolidMolecular weight:747.82β-catenin peptide
CAS:<p>β-catenin peptide,(βCATp) is a naturally occurring self-peptide presented by Kb that very efficiently mediates positive selection of the OT-I thymocytes.</p>Formula:C49H76N12O15Purity:98%Color and Shape:SolidMolecular weight:1073.2Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Purity:98%Color and Shape:SolidMolecular weight:3692.15Fibrinogen-Binding Peptide
CAS:<p>Fibrinogen-binding peptide mimics vitronectin site and activates platelets; thrombin turns it to fibrin.</p>Formula:C25H39N7O8Purity:98%Color and Shape:SolidMolecular weight:565.62WT-1 A1
CAS:<p>WT-1 A1 is an attractive target for immunotherapy in patients with pancreatic adenocarcinoma.</p>Formula:C55H74N10O13SPurity:98%Color and Shape:SolidMolecular weight:1115.3type I hair keratin fragment [Homo sapiens]/[Ovis aries]/[Rattus norvegicus]
<p>Type I human hair keratin has 9 members in 3 groups: A (hHa1, hHa3-I/II, hHa4), B (hHa7, hHa8), and disparate C (hHa2, hHa5, hHa6).</p>Formula:C47H77N13O15Purity:98%Color and Shape:SolidMolecular weight:1064.19Sperm-activating peptide 1
CAS:<p>Sperm-activating peptide 1 is a bioactive chemical.</p>Formula:C44H71N11O12S2Purity:98%Color and Shape:SolidMolecular weight:1010.23Smcy HY Peptide (738-746)
CAS:<p>Smcy HY Peptide (738-746) is an H2-Db-restricted peptide, derived from the amino acid sequence 738 to 746 of the Smcy protein.</p>Formula:C48H82N18O14SPurity:98%Color and Shape:SolidMolecular weight:1167.34Pep1-TGL
<p>Peptide containing the 'TGL' motif that corresponds to the C-terminus of GluR1 subunit</p>Formula:C41H71N11O15SPurity:98%Color and Shape:SolidMolecular weight:990.14Selank
CAS:<p>Selank is a synthetic analog of tuftsin.</p>Formula:C33H57N11O9Purity:98%Color and Shape:SolidMolecular weight:751.87GRP (porcine)
CAS:<p>GRP: agonist for GRPR, stimulates amygdala GABA release reducing fear in mice, aids mitogenesis, GI function, and appetite control.</p>Formula:C126H198N38O31S2Purity:98%Color and Shape:SolidMolecular weight:2805.31CLIP (86-100) (TFA) (648881-58-7 free base)
<p>CLIP (86-100) TFA is a fragment of the invariant chain peptide in the HLA-II groove.</p>Formula:C74H129F3N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1788.13PYX 1
CAS:<p>PYX 1 is an effective orexigenic peptide.</p>Formula:C70H105Cl2N19O16Purity:98%Color and Shape:SolidMolecular weight:1539.61Pam2CSK4 Biotin
biotinylated Pam2CSK4, a toll-like receptor 2/6 agonistFormula:C87H162N14O16S2Purity:98%Color and Shape:SolidMolecular weight:1724.44Protein Kinase C Peptide Substrate
CAS:<p>PKC Peptide Substrate acts on cell spacers, driven by second messengers/adaptors due to external signals via g protein/tyrosine kinase receptors.</p>Formula:C83H155N39O21SPurity:98%Color and Shape:SolidMolecular weight:2067.43Thymocartin
CAS:<p>Thymocartin (RGH 0206) is a fragment 32-35 of the naturally occurring thymic factor (thymopoietin).Thymocartin is used in the study of immunodeficiency diseases</p>Formula:C21H40N8O7Purity:98%Color and Shape:SolidMolecular weight:516.59Maraciclatide
CAS:<p>Maraciclatide is a radiopharmaceutical targeting αvβ3 integrin.</p>Formula:C72H120N20O21S3Purity:98%Color and Shape:SolidMolecular weight:1698.05Lamin fragment
<p>Lamin: α-helical, intermediate filament protein; key in nuclear lamina structure & nuclear functions; sequence: Lys-Ala-Gly-Gln-Val-Val-Thr-Ile-Trp.</p>Formula:C47H76N12O12Purity:98%Color and Shape:SolidMolecular weight:1001.18VIP(Guinea pig)
CAS:<p>Neuropeptide with many biological actions</p>Formula:C147H239N43O42S2Purity:98%Color and Shape:SolidMolecular weight:3344.86

