
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30306 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
[Trp11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formula:C80H122N22O19Molecular weight:1,696 g/molH-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH
CAS:H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a proteolytic inhibitor that inhibits the aspartic and hydrolytic enzymes. It has been shown to inhibit the activity of trypsin, pepsin, and elastase in human serum. This inhibitor also inactivates fibronectin by proteolysis. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu OH has been shown to be specific for acidic proteases such as pepsin. The natural inhibitors of this peptide are Pro, Thr, Glu, Phe, Arg and Leu.Formula:C44H63N11O13Purity:Min. 95%Color and Shape:PowderMolecular weight:954.04 g/molCalcium/Calmodulin Dependent Protein Kinase II-g (345-358)
<p>Catalogue peptide; min. 95% purity</p>Formula:C58H107N21O22Molecular weight:1,450.63 g/mol(D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-Ser(tBu)6,D-Leu7,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C59H84N18O14Purity:Min. 95%Molecular weight:1,269.41 g/molLys-(Hyp3)-Bradykinin
<p>Catalogue peptide; min. 95% purity</p>Formula:C56H85N17O13Molecular weight:1,204.41 g/molBiotin-Secretin, human
<p>Catalogue peptide; min. 95% purity</p>Formula:C140H234N46O42SMolecular weight:5,465.80 g/molAmyloid Bri Protein (1-34) (reduced)
<p>Catalogue peptide; min. 95% purity</p>Formula:C173H275N49O52S2Molecular weight:3,937.55 g/molBiotin-[Glu1]-Gastrin I (human) (phosphorylated)
<p>Catalogue peptide; min. 95% purity</p>Formula:C107H141N22O37PS2Molecular weight:2,422.53 g/molDynorphin A (3-13), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C64H114N22O12Molecular weight:1,383.76 g/molAmyloid Dan Protein (1-34)
<p>Catalogue peptide; min. 95% purity</p>Formula:C185H268N48O51S2Molecular weight:4,044.63 g/molPRRS-RSAB-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H61N11O18Molecular weight:1,020.03 g/mol[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) ((Ala286)-CaMK-II (281-302))
<p>Catalogue peptide; min. 95% purity</p>Formula:C111H191N39O29S2Molecular weight:2,600.07 g/molHPV-E6-C
<p>Catalogue peptide; min. 95% purity</p>Formula:C110H178N36O30SMolecular weight:2,516.92 g/molGRF (free acid) (human)
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C215H357N71O67SMolecular weight:5,040.74 g/molAmyloid beta-Protein (33-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C41H74N10O11SMolecular weight:915.17 g/molα-Neo-Endorphin Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H102N20O13Molecular weight:1,383.68 g/molPKA Regulatory Subunit II Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C92H151N28O32PMolecular weight:2,192.39 g/molAGRP (87-132), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C219H339N65O63S11Molecular weight:5,243.17 g/molHuman ACTH(18-39) trifluoroacetate
CAS:<p>Please enquire for more information about Human ACTH(18-39) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C112H165N27O36•(C2HF3O2)x
