
Peptides
Subcategories of "Peptides"
Found 29900 products of "Peptides"
H-VSLATVDK^-OH
Peptide H-VSLATVDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLTLFNVTR^-OH
Peptide H-TLTLFNVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH
Peptide H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQK^GK^K^NDWK^HNITQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TTEPVSELLK^-OH
Peptide H-TTEPVSELLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ATFNPAQDK^-OH
Peptide H-ATFNPAQDK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H3(1-14)K4me3
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
H-TVLAVFGK^-OH
Peptide H-TVLAVFGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQELESETLK^-OH
Peptide H-FQELESETLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FGGNPGGFGNQGGFGNSR^^-OH
Peptide H-FGGNPGGFGNQGGFGNSR^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Ac-Asp-pNA
CAS:Ac-Asp-pNA is a carboxy, serine protease that is used as an antigen in bactericidal and antibacterial assays. It also has been shown to be effective against neutral ph organisms such as E. coli and Pseudomonas aeruginosa. Ac-Asp-pNA elutes from the column when it is inactivated under neutral ph conditions, which can be seen by the presence of reactive peaks. The protonation of Ac-Asp-pNA at high pH results in a loss of reactivity, which can be detected by the diminazene peak at low pH. This protein is activated by potassium ions and cellular proteins, which can be seen by the presence of peaks at m/z 816 and 806 respectively.Formula:C12H13N3O6Purity:Min. 98 Area-%Color and Shape:PowderMolecular weight:295.25 g/molH-YPDAVATWLNPDPSQK^-OH
Peptide H-YPDAVATWLNPDPSQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Biot-XXXXXX-OH
Peptide Biot-XXXXXX-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LLAEELPLR^-OH
Peptide H-LLAEELPLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YASESMSGI^P^SR-OH
Peptide H-YASESMSGI^P^SR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HQGLPQEVLNENLLR^-OH
Peptide H-HQGLPQEVLNENLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-DRVYI^HPFHL-OH
Peptide H-DRVYI^HPFHL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
matrix protein (3-15) [Zaire ebolavirus]
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool
Formula:C69H110N16O20SMolecular weight:1,515.77 g/molH-TPEVDDEALEK^-OH
Peptide H-TPEVDDEALEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-AMC hydrochloride
CAS:H-Arg-AMC hydrochloride is a denaturing agent that is used to prevent the proteolytic degradation of proteins in muscle and other tissues. It has been shown to inhibit the activity of lipase, myofibrillar, and endoplasmic enzymes. H-Arg-AMC hydrochloride also has cancer preventive effects by inhibiting the growth of tumor cells. H-Arg-AMC hydrochloride has been shown to have high values in notochord markers, supplementing cytosolic markers, and endogenous markers.Formula:C16H21N5O3·xHClPurity:Min. 95%Color and Shape:White PowderMolecular weight:331.37 g/molH-ILGG-NH2
Peptide H-ILGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
