
Peptides
Subcategories of "Peptides"
Found 29634 products of "Peptides"
Cbz-D-Arg-Gly-Arg-pNA
Peptide Cbz-D-Arg-Gly-Arg-pNA is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH
Peptide H-VGGASSLENTVDLHISNSHPLSLTSDQYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NSQVWLGR^-OH
Peptide H-NSQVWLGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-Arg-Ala-Asp-Ser-Lys-OH
H-Arg-Ala-Asp-Ser-Lys-OH is a peptide that is used in biochemistry research as a substrate for protease enzymes. It has the sequence H-Arg-Ala-Asp-Ser-Lys and is labeled with a fluorescent dye.Formula:C22H41N9O9Purity:Min. 95%Molecular weight:575.63 g/molH-VLHPLEGAVVIIFK^-OH
Peptide H-VLHPLEGAVVIIFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-IVGG-NH2
Peptide H-IVGG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Ac-CA-NH2
Peptide Ac-CA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-SSIMR^-OH
Peptide H-SSIMR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NVPLPVIAELPPK^-OH
Peptide H-NVPLPVIAELPPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Fluor-QEDIIRNIARHLAQVGDSMDR-OH
Peptide Fluor-QEDIIRNIARHLAQVGDSMDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-ALP^AP^IEK^-OH
Peptide H-ALP^AP^IEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
δ Sleep Inducing Peptide
Peptide Delta Sleep Inducing Peptide is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
Formula:C35H48N10O15Molecular weight:848.83 g/molH-LDLER^-OH
Peptide H-LDLER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-K^CNTA^TCATQRLANFLVHSSNNFGAILSSTNVG^SNTY-NH2
H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool
H-Myr-GSNK^SK^PK-NH2
Peptide H-Myr-GSNK^SK^PK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HIATNAVLFFGR^-OH
Peptide H-HIATNAVLFFGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LDELLQSQIEK^-OH
Peptide H-LDELLQSQIEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
SIVmac239 - 104
Custom research peptide; min purity 95%. For different specs please use the Peptide Quote ToolMolecular weight:1,697.1 g/molAc-CRKEAQHKRQHLERDLPDPLDQK-NH2
Peptide Ac-CRKEAQHKRQHLERDLPDPLDQK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2
Peptide H-GIGAVLKVLTTGLPALISWIKRKRQQC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
