
Peptides
Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.
Subcategories of "Peptides"
Found 30479 products of "Peptides"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Fluor-GAGSLQPLALEGSLQKRG-OH
<p>Peptide Fluor-GAGSLQPLALEGSLQKRG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Ac-CDDYYYGFGCNKFGRPRDD-NH2
<p>Peptide Ac-CDDYYYGFGCNKFGRPRDD-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-TVLDSGISEVR^-OH
<p>Peptide H-TVLDSGISEVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
<p>Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM).</p>H-LNIPTDVLK^-OH
<p>Peptide H-LNIPTDVLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Fmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB
<p>Please enquire for more information about Fmoc-Tyr(tBu)-Wang Resin (100-200 mesh) 1% DVB including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%Biot-KKLNRTLSFAEPG-NH2
<p>Peptide Biot-KKLNRTLSFAEPG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Neuropeptide Y (free acid) (human)
CAS:<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>Formula:C189H284N54O58S1Molecular weight:4,272.8 g/molH-APRWDAPLRDPAL^-OH
<p>Peptide H-APRWDAPLRDPAL^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>H-Pro-His-Ser-Arg-Asn-OH
<p>H-Pro-His-Ser-Arg-Asn-OH is a synthetic peptide that binds to the α subunit of the nicotinic acetylcholine receptor. It is an inhibitor of the receptor and blocks the binding of acetylcholine to this receptor. H-Pro-His-Ser-Arg-Asn-OH has been used as a research tool in pharmacology, cell biology, and immunology.</p>Formula:C24H39N11O8Purity:Min. 95%Molecular weight:609.6 g/molMyosin H Chain Fragment(615-630), Mouse
<p>Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool</p>H-γ-Abu-2-ClTrt-Resin (100-200 mesh) 1% DVB
<p>H-γ-Abu-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin used as a building block in peptide synthesis. The resin is composed of N-(2-chloroethyl)-N,N'-bis(2,3,5,6-tetrafluorohexyl)trimethoxysilane. Resins are inert and insoluble in organic solvents. They are very useful in peptide synthesis because they can be used to link amino acids together by forming amide bonds.</p>Purity:Min. 95%Z-His-Glu-Lys-AMC
CAS:<p>Z-His-Glu-Lys-AMC is an activator of ion channels. It is a ligand that binds to the receptor and stimulates the opening of ion channels in cells. Z-His-Glu-Lys-AMC has been used as a research tool to study protein interactions, pharmacology, and cell biology. It has also been used to study ion channel function and its role in diseases such as epilepsy or schizophrenia.</p>Formula:C35H41N7O9Purity:Min. 95%Molecular weight:703.74 g/molCyclo(Arg-Gly-Asp-D-Phe-Glu)
<p>Cyclo(Arg-Gly-Asp-D-Phe-Glu) is a peptide linker that is synthesized using solid phase synthesis. It has been shown to be cytotoxic to cancer cells in vitro and in vivo, with an IC50 of less than 15 μM in three different types of cancer cell lines. Cyclo(Arg-Gly-Asp-D-Phe-Glu) has a high uptake rate, which may be due to its ability to bind to the amino acid residue glutamic acid on the surface of cancer cells. This peptide also has a prognostic value for pancreatic cancer, as patients with increased levels of Cyclo(Arg-Gly-Asp-D-Phe-Glu) have a poorer prognosis.</p>Formula:C26H36N8O9Purity:Min. 95%Molecular weight:604.63 g/molHIF-1 α (556-574)
<p>HIF-1 alpha (556-574) is derived from hypoxia-inducible factor 1-alpha (HIF-1 alpha), a subunit of the heterodimeric transcription factor HIF-1 and is responsible for maintaining oxygen homeostasis. HIF-1 alpha is expressed under hypoxic conditions and is oxygen sensitive. Hypoxia can occur in cancer, heart disease and pulmonary disorders.Structurally HIF-1 alpha contains a N-terminal transactivation domain (N-TAD) which stabilises HIF-1 alpha and a C-terminal transactivation domain (C-TAD) which under hypoxic conditions regulates the transcription of HIF-1 alpha. Moreover HIF-1 alpha features an oxygen dependent degradation domain containing two proline residues and a lysine532. The two proline residues are substrates of prolyl-4-hydroxylases (PHDs) which in the presence of sufficient oxygen, are hydroxylated. Similarly the lysine residue is acetylated by arrest-defective-1 and this is reduced in hypoxic conditions. These hydroxylated prolines and acetylated lysine target HIF-1 alpha for ubiquitination and degradation.</p>Purity:Min. 95%Color and Shape:PowderMolecular weight:2,253 g/molAc-ILRTQESEC-NH2
<p>Peptide Ac-ILRTQESEC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>FA-Phe-Gly-Gly-OH
CAS:<p>FA-Phe-Gly-Gly-OH is a peptide with angiotensin II inhibitory properties. It has been shown that FA-Phe-Gly-Gly-OH inhibits the enzyme activity of angiotensin converting enzyme (ACE) and prevents the formation of angiotensin II, which causes blood vessel constriction. The inhibitory effects of FA-Phe-Gly-Gly-OH on ACE are reversible and competitive, which is different from other ACE inhibitors that are irreversible and noncompetitive. This peptide also has antioxidative properties, due to its ability to scavenge reactive oxygen species (ROS). This peptide can be hydrolysed by esterases or proteases in vitro or in vivo.</p>Formula:C20H21N3O6Purity:Min. 95%Color and Shape:White PowderMolecular weight:399.4 g/molH-Val-AMC
CAS:<p>H-Val-AMC is a scleral depressant that has been shown to lower intraocular pressure (IOP) in humans and animals. It is a non-penetrating agent that has been show to be well tolerated in humans with no significant side effects. H-Val-AMC can be used as an alternative to medications such as timolol, which are not well tolerated by many patients. The effectiveness of H-Val-AMC is statistically significant when compared to timolol and other agents, but it does not produce a substantial reduction in IOP. This drug should be administered in conjunction with other glaucoma treatment methods including positioning, suturing, perimetry, pachymetry and sclerectomy.</p>Formula:C15H18N2O3Purity:Min. 95%Color and Shape:PowderMolecular weight:274.32 g/molCys(Npys)-TAT (49-57), FAM-labeled
<p>Cys- Activated and FAM-labeled TAT for Cargo Conjunction. This product is available as a trifluoroacetate salt</p>Formula:C88H136N36O20S2Purity:Min. 95%Molecular weight:2,082.42 g/molCalcitonin (salmon) acetate
CAS:Controlled Product<p>Calcitonin (salmon) acetate is a peptide hormone that is naturally produced by the parafollicular cells of salmon. It contains a disulphide bridge between two cysteine residues, which is crucial for its biological activity. This hormone plays an important role in regulating calcium levels in the body and is commonly used in life sciences research. Calcitonin (salmon) acetate has been shown to have potent effects on bone metabolism, making it a valuable tool for studying osteoporosis and other bone disorders. Its unique structure and function make it an essential component of biochemical studies and research in the field of endocrinology.</p>Formula:C145H240N44O48S2•(C2H4O2)xPurity:Min. 95%Color and Shape:Powder
