Peptides
Subcategories of "Peptides"
Found 29713 products of "Peptides"
H-TKCVIF-OH
Peptide H-TKCVIF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LPLLPIFFCLWVYI-OH
Peptide H-LPLLPIFFCLWVYI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VFSNGADLSGVTEEAPLK-OH
Peptide H-VFSNGADLSGVTEEAPLK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-TLYLQMNSL-OH
Peptide H-TLYLQMNSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IRQYLAQWLE-OH
Peptide H-IRQYLAQWLE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GFQALGDAADIR-OH
Peptide H-GFQALGDAADIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH
Peptide H-FTLIELLIVVAIIGILAAIAIPQFSAYRVKAYNSAASSDLRNLKTALESAFADDQTYPPES-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FQTKGLGISYGR-OH
Peptide H-FQTKGLGISYGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-PFVQWFVGL-OH
Peptide H-PFVQWFVGL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VTITIQ-OH
Peptide H-VTITIQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.Molecular weight:673.81 g/molH-SDTFPRCDCSS-OH
Peptide H-SDTFPRCDCSS-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-NTVISVNPSTK-OH
Peptide H-NTVISVNPSTK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VNYDFTIV-OH
Peptide H-VNYDFTIV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-IPAMVVDR-OH
Peptide H-IPAMVVDR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-KLGGALQAK-OH
Peptide H-KLGGALQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-QNLAKASPVYLDILG-OH
Peptide H-QNLAKASPVYLDILG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VADFAPPGA-OH
Peptide H-VADFAPPGA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-GLFEAIEGFIENGWEGMIDGWYGC-OH
Peptide H-GLFEAIEGFIENGWEGMIDGWYGC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-AQALEQAK-OH
Peptide H-AQALEQAK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-YEALLLGGLPQEGLAR-OH
Peptide H-YEALLLGGLPQEGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
