Peptides
Subcategories of "Peptides"
Found 29729 products of "Peptides"
H-GPSVFPLAPSSR-OH
Peptide H-GPSVFPLAPSSR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DMRQTVAVGVIK-OH
Peptide H-DMRQTVAVGVIK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-EKDPIKENY-OH
Peptide H-EKDPIKENY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-EIMAEIYK-OH
Peptide H-EIMAEIYK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GVYYPDK-OH
Peptide H-GVYYPDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-VISNDVCAQV-OH
Peptide H-VISNDVCAQV-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-ASGYTFTSYNMHWVK-OH
Peptide H-ASGYTFTSYNMHWVK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-SGGGGSGGGGSGGGG-OH
Peptide H-SGGGGSGGGGSGGGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-VAGFNLLMTLR-OH
Peptide H-VAGFNLLMTLR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HLAAQGMAY-OH
Peptide H-HLAAQGMAY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-GILGLVFTL-OH
Peptide H-GILGLVFTL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LLQDSVDFSL-OH
Peptide H-LLQDSVDFSL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-LVQAFQFTDK-OH
Peptide H-LVQAFQFTDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-FLSFHISNL-OH
Peptide H-FLSFHISNL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-CYENPQVIASQQL-OH
Peptide H-CYENPQVIASQQL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-LFLAEFQSIPR-OH
Peptide H-LFLAEFQSIPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH
H-TYLMFWIGVTSVLLLFIVYAYMYILWYGRKKRRQRRR-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote ToolFormula:C229H352N60O47S2Molecular weight:4,761.81 g/molH-ILDFGLAR-OH
Peptide H-ILDFGLAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.H-DTDILAAFR-OH
Peptide H-DTDILAAFR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
H-HPVGEADYF-OH
Peptide H-HPVGEADYF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.
